Rv0011c
- Type
- protein_coding
- Name
- Rv0011c
- Locus Name
-
Rv0011c
- Product
-
Probable conserved transmembrane protein
- Functional Category
-
Cell wall and cell processes
- Location
- 13714..13995 (- strand)
- Gene Length
- 281 bp
- Nucleotides
-
ATGCCCAAGTCCAAGGTCCGCAAGAAGAACGACTTCACCGTCAGCGCGGTGAGCCGCACGCCGATGAAGGTGAAGGTCGGACCGTCGAGCGTATGGTTCGTCTCGTTGTTCATCGGTCTGATGCTGATCGGACTCATCTGGTTAATGGTGTTTCAGTTGGCAGCCATTGGCAGCCAAGCCCCCACAGCGCTCAATTGGATGGCGCAACTCGGTCCCTGGAACTATGCGATCGCGTTCGCTTTCATGATCACCGGTTTGTTGCTCACGATGCGCTGGCATTG
- Drug Resistance
- Mutations
- Function
- Involved in cell division. Plays an important role in septal peptidoglycan synthesis and cell shape morphogenesis. May facilitate the recruitment of the peptidoglycan synthesis machinery to poles and septal zones and coordinate peptidoglycan synthesis at these sites. {ECO:0000255|HAMAP-Rule:MF_00631, ECO:0000269|PubMed:21531798, ECO:0000269|PubMed:23002219}.
- Family
-
CrgA family
- GO
-
- cell cycle GO:0007049 biological_process
- integral component of plasma membrane GO:0005887 cellular_component
- regulation of cell shape GO:0008360 biological_process
- cell division GO:0051301 biological_process
- InterPro
2MMU
- Name
- Cell division protein CrgA
- Family
- CrgA family
- Protein Sequence
-
MPKSKVRKKNDFTVSAVSRTPMKVKVGPSSVWFVSLFIGLMLIGLIWLMVFQLAAIGSQAPTALNWMAQLGPWNYAIAFAFMITGLLLTMRWH
- Mass
- 10,430 Da
- Length
- 93 Aa
Summary
Rv0011c doesn't seem to be a targeted by any drug.
Rv0011c doesn't seem to be involved in any pathway.
- Mycobacterium tuberculosis CwsA interacts with CrgA and Wag31, and the CrgA-CwsA complex is involved in peptidoglycan synthesis and cell shape determination.
- J Bacteriol. 2012 Dec;194(23):6398-409. doi: 10.1128/JB.01005-12. Epub 2012 Sep 21.
- Characterization of CrgA, a new partner of the Mycobacterium tuberculosis peptidoglycan polymerization complexes.
- J Bacteriol. 2011 Jul;193(13):3246-56. doi: 10.1128/JB.00188-11. Epub 2011 Apr 29.
- Deciphering the biology of Mycobacterium tuberculosis from the complete genome sequence.
- Nature. 1998 Jun 11;393(6685):537-44. doi: 10.1038/31159.