trpG
- Type
- protein_coding
- Name
- trpG
- Locus Name
-
Rv0013
- Product
-
Possible anthranilate synthase component II TrpG (glutamine amidotransferase)
- Functional Category
-
Intermediary metabolism and respiration
- Location
- 14914..15612 (+ strand)
- Gene Length
- 698 bp
- Nucleotides
-
TGCGGATCCTGGTCGTTGACAACTACGACAGCTTCGTGTTCAACCTGGTGCAGTACCTCGGCCAGCTCGGCATCGAGGCCGAGGTGTGGCGCAACGACGACCACCGGCTATCCGATGAGGCCGCCGTCGCCGGCCAATTCGACGGTGTCCTGCTCAGTCCCGGTCCGGGTACCCCGGAGCGCGCGGGCGCGTCGGTGAGTATCGTGCACGCGTGTGCGGCAGCACACACCCCTTTGCTGGGGGTCTGCCTTGGGCACCAAGCCATCGGCGTTGCGTTCGGCGCCACCGTGGACCGTGCGCCCGAGCTATTGCACGGCAAGACCAGCAGCGTATTCCACACCAATGTCGGTGTGCTACAAGGGCTTCCGGATCCCTTCACGGCCACTCGATACCATTCGTTGACAATTCTGCCTAAGTCGCTGCCAGCGGTGCTGAGGGTCACGGCCCGCACTAGCAGCGGTGTGATCATGGCCGTGCAGCACACCGGGCTGCCGATCCACGGTGTCCAGTTCCATCCGGAGTCGATTCTCACCGAGGGCGGGCACCGCATACTGGCCAACTGGCTCACCTGCTGCGGATGGACGCAAGACGACACCCTGGTACGTCGGCTGGAAAACGAAGTGCTCACCGCCATCTCACCGCACTTCCCAACTTCAACCGCTAGCGCGGGCGAAGCTACTGGCCGAACCTCAGCGTGA
- Drug Resistance
- Mutations
- Function
- Part of a heterotetrameric complex that catalyzes the two-step biosynthesis of anthranilate, an intermediate in the biosynthesis of L-tryptophan. In the first step, the glutamine-binding beta subunit (TrpG) of anthranilate synthase (AS) provides the glutamine amidotransferase activity which generates ammonia as a substrate that, along with chorismate, is used in the second step, catalyzed by the large alpha subunit of AS (TrpE) to produce anthranilate. In the absence of TrpG, TrpE can synthesize anthranilate directly from chorismate and high concentrations of ammonia (By similarity). {ECO:0000250}.
- Family
-
Unknown
- GO
-
- plasma membrane GO:0005886 cellular_component
- tryptophan biosynthetic process GO:0000162 biological_process
- glutamine metabolic process GO:0006541 biological_process
- anthranilate synthase activity GO:0004049 molecular_function
- InterPro
Summary
- Name
- Anthranilate synthase component 2 (AS) (ASII) (EC 4.1.3.27) (Anthranilate synthase, GATase component) (Anthranilate synthase, glutamine amidotransferase component)
- Family
- Unknown
- Protein Sequence
-
MRILVVDNYDSFVFNLVQYLGQLGIEAEVWRNDDHRLSDEAAVAGQFDGVLLSPGPGTPERAGASVSIVHACAAAHTPLLGVCLGHQAIGVAFGATVDRAPELLHGKTSSVFHTNVGVLQGLPDPFTATRYHSLTILPKSLPAVLRVTARTSSGVIMAVQHTGLPIHGVQFHPESILTEGGHRILANWLTCCGWTQDDTLVRRLENEVLTAISPHFPTSTASAGEATGRTSA
- Mass
- 24,627 Da
- Length
- 232 Aa
Rv0013 doesn't seem to be a targeted by any drug.
-
-
Folate biosynthesis mtu00790
mtu00790PATHWAY_MAP mtu00790 Folate biosynthesis
-
- Proteogenomic analysis of Mycobacterium tuberculosis by high resolution mass spectrometry.
- Mol Cell Proteomics. 2011 Dec;10(12):M111.011627. doi: 10.1074/mcp.M111.011445. Epub 2011 Oct 3.
- targetTB: a target identification pipeline for Mycobacterium tuberculosis through an interactome, reactome and genome-scale structural analysis.
- BMC Syst Biol. 2008 Dec 19;2:109. doi: 10.1186/1752-0509-2-109.
- Deciphering the biology of Mycobacterium tuberculosis from the complete genome sequence.
- Nature. 1998 Jun 11;393(6685):537-44. doi: 10.1038/31159.