fhaB
- Type
- protein_coding
- Name
- fhaB
- Locus Name
-
Rv0019c
- Product
-
Conserved protein with FHA domain, FhaB
- Functional Category
-
Regulatory proteins
- Location
- 23270..23737 (- strand)
- Gene Length
- 467 bp
- Nucleotides
-
ATGCAGGGGTTGGTACTGCAACTGACGCGTGCCGGATTCTTGATGTTGTTGTGGGTATTCATCTGGTCCGTGCTACGGATCTTGAAGACCGACATTTATGCGCCGACCGGCGCGGTCATGATGCGCCGCGGCCTGGCGCTGCGAGGGACGCTCTTAGGCGCGCGTCAGCGCCGGCACGCTGCACGCTACCTGGTGGTGACCGAAGGTGCGTTGACTGGCGCGCGTATCACGCTGAGCGAACAGCCGGTGTTGATCGGGCGCGCCGACGACTCGACCCTGGTGCTGACCGACGACTACGCCTCGACGCGGCACGCTCGGCTGTCTATGCGCGGCTCCGAGTGGTACGTCGAAGATCTAGGATCGACCAACGGCACTTACCTGGACAGGGCGAAGGTGACGACTGCGGTACGAGTTCCGATCGGAACGCCGGTTCGCATCGGCAAAACTGCAATCGAGTTGCGCCCGTG
- Drug Resistance
- Mutations
- Function
- Regulates growth and cell division. Probably required for divisomal protein assembly under oxidative stress. {ECO:0000269|PubMed:20066037}.
- Family
-
Unknown
- GO
-
- growth of symbiont in host cell GO:0044119 biological_process
- extracellular region GO:0005576 cellular_component
- plasma membrane GO:0005886 cellular_component
- cell division GO:0051301 biological_process
- response to oxidative stress GO:0006979 biological_process
- integral component of membrane GO:0016021 cellular_component
- InterPro
Summary
- Name
- FHA domain-containing protein FhaB (FtsZ-interacting protein A)
- Family
- Unknown
- Protein Sequence
-
MQGLVLQLTRAGFLMLLWVFIWSVLRILKTDIYAPTGAVMMRRGLALRGTLLGARQRRHAARYLVVTEGALTGARITLSEQPVLIGRADDSTLVLTDDYASTRHARLSMRGSEWYVEDLGSTNGTYLDRAKVTTAVRVPIGTPVRIGKTAIELRP
- Mass
- 17,152 Da
- Length
- 155 Aa
Rv0019c doesn't seem to be a targeted by any drug.
Rv0019c doesn't seem to be involved in any pathway.
- Proteogenomic analysis of Mycobacterium tuberculosis by high resolution mass spectrometry.
- Mol Cell Proteomics. 2011 Dec;10(12):M111.011627. doi: 10.1074/mcp.M111.011445. Epub 2011 Oct 3.
- Novel role of phosphorylation-dependent interaction between FtsZ and FipA in mycobacterial cell division.
- PLoS One. 2010 Jan 6;5(1):e8590. doi: 10.1371/journal.pone.0008590.
- Forkhead-associated domain-containing protein Rv0019c and polyketide-associated protein PapA5, from substrates of serine/threonine protein kinase PknB to interacting proteins of Mycobacterium tuberculosis.
- J Biol Chem. 2009 Dec 11;284(50):34723-34. doi: 10.1074/jbc.M109.058834. Epub 2009 Oct 13.
- Deciphering the biology of Mycobacterium tuberculosis from the complete genome sequence.
- Nature. 1998 Jun 11;393(6685):537-44. doi: 10.1038/31159.