whiB5
- Type
- protein_coding
- Name
- whiB5
- Locus Name
-
Rv0022c
- Product
-
Probable transcriptional regulatory protein WhiB-like WhiB5
- Functional Category
-
Regulatory proteins
- Location
- 27023..27442 (- strand)
- Gene Length
- 419 bp
- Nucleotides
-
ATGGCACACCCCTGCGCAACCGACCCGGAACTATGGTTCGGGTACCCCGATGACGACGGCAGCGACGGCGCCGCTAAGGCACGCGCCTATGAGCGGTCGGCCACCCAAGCGCGGATCCAATGCCTGCGCCGGTGCCCGCTCCTACAGCAGCGCCGGTGTGCTCAACACGCGGTCGAGCATCGGGTGGAGTACGGCGTATGGGCCGGCATCAAGCTTCCCGGCGGCCAGTACCGAAAGCGCGAACAGCTCGCGGCAGCCCACGACGTGCTGCGTCGGATTGCCGGCGGCGAGATCAATTCCAGGCAGCTCCCGGACAATGCGGCTCTGCTGGCCCGCAACGAAGGACTCGAGGTCACCCCGGTGCCCGGGGTCGTGGTGCACCTGCCGATCGCACAGGTTGGCCCACAACCGGCCGCTTG
- Drug Resistance
- Mutations
- Function
- A transcription factor that is probably redox-responsive. Probably plays a role in immunomodulation and reactivation after chronic infection. Its induction results in transcription of a number of genes including sigM, and the genes for 2 type VII secretion systems ESX-2 and ESX-4. Seems to negatively regulate its own expression. The apo-form has been shown to act as a protein disulfide reductase. The apo- but not holo-form probably binds DNA. {ECO:0000269|PubMed:19016840, ECO:0000269|PubMed:22733573}.
- Family
-
WhiB family
- GO
-
- metal ion binding GO:0046872 molecular_function
- pathogenesis GO:0009405 biological_process
- cell wall GO:0005618 cellular_component
- DNA binding GO:0003677 molecular_function
- regulation of transcription, DNA-templated GO:0006355 biological_process
- cytoplasm GO:0005737 cellular_component
- 4 iron, 4 sulfur cluster binding GO:0051539 molecular_function
- dinitrosyl-iron complex binding GO:0035731 molecular_function
- InterPro
Summary
- Name
- Transcriptional regulator WhiB5
- Family
- WhiB family
- Protein Sequence
-
MAHPCATDPELWFGYPDDDGSDGAAKARAYERSATQARIQCLRRCPLLQQRRCAQHAVEHRVEYGVWAGIKLPGGQYRKREQLAAAHDVLRRIAGGEINSRQLPDNAALLARNEGLEVTPVPGVVVHLPIAQVGPQPAA
- Mass
- 15,178 Da
- Length
- 139 Aa
Rv0022c doesn't seem to be a targeted by any drug.
Rv0022c doesn't seem to be involved in any pathway.
- WhiB5, a transcriptional regulator that contributes to Mycobacterium tuberculosis virulence and reactivation.
- Infect Immun. 2012 Sep;80(9):3132-44. doi: 10.1128/IAI.06328-11. Epub 2012 Jun 25.
- Studies on structural and functional divergence among seven WhiB proteins of Mycobacterium tuberculosis H37Rv.
- FEBS J. 2009 Jan;276(1):76-93. doi: 10.1111/j.1742-4658.2008.06755.x.
- Deciphering the biology of Mycobacterium tuberculosis from the complete genome sequence.
- Nature. 1998 Jun 11;393(6685):537-44. doi: 10.1038/31159.