Gene - combatTB X

fbpC

Type: protein_coding
Name: fbpC
Locus Name: Rv0129c
Product: Secreted antigen 85-C FbpC (85C) (antigen 85 complex C) (AG58C) (mycolyl transferase 85C) (fibronectin-binding protein C)
Functional Category: Lipid metabolism
Location: 156578..157600 (- strand)
Gene Length: 1022 bp
Nucleotides: ATGACGTTCTTCGAACAGGTGCGAAGGTTGCGGAGCGCAGCGACAACCCTGCCGCGCCGGCTGGCTATCGCGGCTATGGGGGCTGTCCTGGTTTACGGTCTGGTCGGTACCTTCGGCGGGCCGGCCACCGCGGGCGCATTCTCTAGGCCCGGTCTTCCAGTGGAATATCTGCAGGTGCCATCCGCGTCGATGGGCCGCGACATCAAGGTCCAGTTCCAGGGCGGCGGACCGCACGCGGTCTACCTGCTCGACGGTCTGCGGGCCCAGGATGACTACAACGGCTGGGACATCAACACCCCGGCCTTCGAGGAGTACTACCAGTCAGGGTTGTCGGTGATCATGCCCGTGGGCGGCCAATCCAGTTTCTACACCGACTGGTATCAGCCCTCGCAGAGCAACGGCCAGAACTACACCTACAAGTGGGAGACCTTCCTTACCAGAGAGATGCCCGCCTGGCTACAGGCCAACAAGGGCGTGTCCCCGACAGGCAACGCGGCGGTGGGTCTTTCGATGTCGGGCGGTTCCGCGCTGATCCTGGCCGCGTACTACCCGCAGCAGTTCCCGTACGCCGCGTCGTTGTCGGGCTTCCTCAACCCGTCCGAGGGCTGGTGGCCGACGCTGATCGGCCTGGCGATGAACGACTCGGGCGGTTACAACGCCAACAGCATGTGGGGTCCGTCCAGCGACCCGGCCTGGAAGCGCAACGACCCAATGGTTCAGATTCCCCGCCTGGTCGCCAACAACACCCGGATCTGGGTGTACTGCGGTAACGGCACACCCAGCGACCTCGGCGGCGACAACATACCGGCGAAGTTCCTGGAAGGCCTCACCCTGCGCACCAACCAGACCTTCCGGGACACCTACGCGGCCGACGGTGGACGCAACGGGGTGTTTAACTTCCCGCCCAACGGAACACACTCGTGGCCCTACTGGAACGAGCAGCTGGTCGCCATGAAGGCCGATATCCAGCATGTGCTCAACGGCGCGACACCCCCGGCCGCCCCTGCTGCGCCGGCCGCCTG
Drug Resistance: Check for drug resistance association at TBDREAMDB
Mutations: Check for mutants available at TARGET

Function

The antigen 85 proteins (FbpA, FbpB, FbpC) are responsible for the high affinity of mycobacteria to fibronectin, a large adhesive glycoprotein, which facilitates the attachment of M.tuberculosis to murine alveolar macrophages (AMs). They also help to maintain the integrity of the cell wall by catalyzing the transfer of mycolic acids to cell wall arabinogalactan and through the synthesis of alpha,alpha-trehalose dimycolate (TDM, cord factor). They catalyze the transfer of a mycoloyl residue from one molecule of alpha,alpha-trehalose monomycolate (TMM) to another TMM, leading to the formation of TDM. {ECO:0000269|PubMed:1830294, ECO:0000269|PubMed:9162010}.

Family

Mycobacterial A85 antigen family

GO

diacylglycerol O-acyltransferase activity GO:0004144 molecular_function
lipid transport GO:0006869 biological_process
transferase activity, transferring acyl groups other than amino-acyl groups GO:0016747 molecular_function
zymogen binding GO:0035375 molecular_function
extracellular region GO:0005576 cellular_component
cell wall GO:0005618 cellular_component
trehalose O-mycolyltransferase activity GO:0050348 molecular_function
glycolipid biosynthetic process GO:0009247 biological_process
response to antibiotic GO:0046677 biological_process
mycolate cell wall layer assembly GO:0071769 biological_process

InterPro

UniProt: P9WQN9
GenBank: Rv0129c
EnsemblBacteria: Rv0129c
Mycobrowser: Rv0129c

PDB IDs:

Summary

Name: Diacylglycerol acyltransferase/mycolyltransferase Ag85C (DGAT) (EC 2.3.1.122) (EC 2.3.1.20) (Acyl-CoA:diacylglycerol acyltransferase) (Antigen 85 complex C) (85C) (Ag85C) (Fibronectin-binding protein C) (Fbps C)
Family: Mycobacterial A85 antigen family
Protein Sequence: MTFFEQVRRLRSAATTLPRRLAIAAMGAVLVYGLVGTFGGPATAGAFSRPGLPVEYLQVPSASMGRDIKVQFQGGGPHAVYLLDGLRAQDDYNGWDINTPAFEEYYQSGLSVIMPVGGQSSFYTDWYQPSQSNGQNYTYKWETFLTREMPAWLQANKGVSPTGNAAVGLSMSGGSALILAAYYPQQFPYAASLSGFLNPSEGWWPTLIGLAMNDSGGYNANSMWGPSSDPAWKRNDPMVQIPRLVANNTRIWVYCGNGTPSDLGGDNIPAKFLEGLTLRTNQTFRDTYAADGGRNGVFNFPPNGTHSWPYWNEQLVAMKADIQHVLNGATPPAAPAAPAA
Mass: 36,771 Da
Length: 340 Aa

Rv0129c doesn't seem to be a targeted by any drug.

Glycerolipid metabolism mtu00561
mtu00561
PATHWAY_MAP mtu00561 Glycerolipid metabolism

Arabinogalactan biosynthesis - Mycobacterium mtu00572
mtu00572
Metabolism; Glycan biosynthesis and metabolism

Design, synthesis and biological evaluation of sugar-derived esters, alpha-ketoesters and alpha-ketoamides as inhibitors for Mycobacterium tuberculosis antigen 85C.: Mol Biosyst. 2009 Sep;5(9):945-56. doi: 10.1039/b902284h. Epub 2009 Jun 19.
Mycobacterium tuberculosis antigen 85A and 85C structures confirm binding orientation and conserved substrate specificity.: J Biol Chem. 2004 Aug 27;279(35):36771-7. doi: 10.1074/jbc.M400811200. Epub 2004 Jun 10.
Crystal structure of the secreted form of antigen 85C reveals potential targets for mycobacterial drugs and vaccines.: Nat Struct Biol. 2000 Feb;7(2):141-6. doi: 10.1038/72413.
The genes coding for the antigen 85 complexes of Mycobacterium tuberculosis and Mycobacterium bovis BCG are members of a gene family: cloning, sequence determination, and genomic organization of the gene coding for antigen 85-C of M. tuberculosis.: Infect Immun. 1991 Sep;59(9):3205-12.
Deciphering the biology of Mycobacterium tuberculosis from the complete genome sequence.: Nature. 1998 Jun 11;393(6685):537-44. doi: 10.1038/31159.
Evidence for three separate genes encoding the proteins of the mycobacterial antigen 85 complex.: Infect Immun. 1990 Jan;58(1):272-4.
Genetic and immunological analysis of Mycobacterium tuberculosis fibronectin-binding proteins.: Infect Immun. 1991 Aug;59(8):2712-8.
Role of the major antigen of Mycobacterium tuberculosis in cell wall biogenesis.: Science. 1997 May 30;276(5317):1420-2. doi: 10.1126/science.276.5317.1420.
Inactivation of the antigen 85C gene profoundly affects the mycolate content and alters the permeability of the Mycobacterium tuberculosis cell envelope.: Mol Microbiol. 1999 Mar;31(5):1573-87.
targetTB: a target identification pipeline for Mycobacterium tuberculosis through an interactome, reactome and genome-scale structural analysis.: BMC Syst Biol. 2008 Dec 19;2:109. doi: 10.1186/1752-0509-2-109.
Proteogenomic analysis of Mycobacterium tuberculosis by high resolution mass spectrometry.: Mol Cell Proteomics. 2011 Dec;10(12):M111.011627. doi: 10.1074/mcp.M111.011445. Epub 2011 Oct 3.