msrA
- Type
- protein_coding
- Name
- msrA
- Locus Name
-
Rv0137c
- Product
-
Probable peptide methionine sulfoxide reductase MsrA (protein-methionine-S-oxide reductase) (peptide met(O) reductase)
- Functional Category
-
Intermediary metabolism and respiration
- Location
- 164712..165260 (- strand)
- Gene Length
- 548 bp
- Nucleotides
-
ATGACGAGCAATCAGAAAGCGATCCTCGCCGGCGGCTGCTTTTGGGGGCTGCAGGATCTGATCCGCAACCAGCCCGGTGTGGTCTCCACGCGGGTGGGCTACAGCGGCGGGAACATCCCCAACGCAACCTACCGTAACCACGGCACGCACGCCGAAGCCGTCGAAATCATCTTCGACCCCACGGTCACCGATTACCGCACCCTGCTGGAATTCTTCTTCCAGATCCACGACCCGACAACCAAAGACCGGCAAGGTAACGACCGGGGGACCAGCTACCGGTCGGCCATCTTCTACTTCGATGAGCAGCAAAAGCGGATCGCGCTGGACACCATCGCCGATGTCGAGGCATCCGGCCTGTGGCCCGGCAAGGTGGTGACCGAGGTCAGCCCGGCCGGGGATTTCTGGGAAGCCGAACCCGAGCACCAGGACTACCTGCAGCGCTACCCCAACGGGTACACGTGCCACTTCGTCCGGCCCGGCTGGAGGCTACCCCGACGGACCGCCGAATCTGCACTGCGGGCCAGCCTTTCACCCGAACTCGGGACCTG
- Drug Resistance
- Mutations
- Function
- Has an important function as a repair enzyme for proteins that have been inactivated by oxidation. Catalyzes the reversible oxidation-reduction of methionine sulfoxide in proteins to methionine. {ECO:0000255|HAMAP-Rule:MF_01401}.
- Family
-
MsrA Met sulfoxide reductase family
- GO
-
- cellular response to oxidative stress GO:0034599 biological_process
- L-methionine-(S)-S-oxide reductase activity GO:0036456 molecular_function
- cytosol GO:0005829 cellular_component
- evasion or tolerance by symbiont of host-produced nitric oxide GO:0052060 biological_process
- cytoplasm GO:0005737 cellular_component
- response to nitrosative stress GO:0051409 biological_process
- peptide-methionine (S)-S-oxide reductase activity GO:0008113 molecular_function
- L-methionine:thioredoxin-disulfide S-oxidoreductase activity GO:0033744 molecular_function
- cellular protein modification process GO:0006464 biological_process
- response to oxidative stress GO:0006979 biological_process
- InterPro
1NWA
- Name
- Peptide methionine sulfoxide reductase MsrA (Protein-methionine-S-oxide reductase) (EC 1.8.4.11) (Peptide-methionine (S)-S-oxide reductase) (Peptide Met(O) reductase)
- Family
- MsrA Met sulfoxide reductase family
- Protein Sequence
-
MTSNQKAILAGGCFWGLQDLIRNQPGVVSTRVGYSGGNIPNATYRNHGTHAEAVEIIFDPTVTDYRTLLEFFFQIHDPTTKDRQGNDRGTSYRSAIFYFDEQQKRIALDTIADVEASGLWPGKVVTEVSPAGDFWEAEPEHQDYLQRYPNGYTCHFVRPGWRLPRRTAESALRASLSPELGT
- Mass
- 20,485 Da
- Length
- 182 Aa
Summary
Rv0137c doesn't seem to be a targeted by any drug.
-
-
Tolerance by Mtb to nitric oxide produced by macrophages R-HSA-1222538
Homo sapiensR-HSA-1222538
-
- Proteogenomic analysis of Mycobacterium tuberculosis by high resolution mass spectrometry.
- Mol Cell Proteomics. 2011 Dec;10(12):M111.011627. doi: 10.1074/mcp.M111.011445. Epub 2011 Oct 3.
- Deciphering the biology of Mycobacterium tuberculosis from the complete genome sequence.
- Nature. 1998 Jun 11;393(6685):537-44. doi: 10.1038/31159.