pntAb
- Type
- protein_coding
- Name
- pntAb
- Locus Name
-
Rv0156
- Product
-
Probable NAD(P) transhydrogenase (subunit alpha) PntAb [second part; integral membrane protein] (pyridine nucleotide transhydrogenase subunit alpha) (nicotinamide nucleotide transhydrogenase subunit alpha)
- Functional Category
-
Intermediary metabolism and respiration
- Location
- 184723..185055 (+ strand)
- Gene Length
- 332 bp
- Nucleotides
-
TGTACAACGAATTGTTGGAGAACCTGGCGATCCTGGTGCTGTCCGGATTCGTCGGGTTCGCGGTGATCTCGAAAGTGCCCAACACGTTGCACACCCCGCTGATGTCAGGAACCAACGCCATCCACGGCATTGTCGTTCTCGGCGCGCTGGTGGTTTTCGGCGAAATTGAGCACCCATCGCTCGTGTTGCAGGTCATCCTGTTCGTCGCGGTGGTGTTCGGCACGCTGAACGTCATCGGCGGATTCATCGTCACCGACCGAATGCTCGGCATGTTCAAGGCCAAGAAGCCCGCCGTGCCAGCCAAGCCCGACCGCGACGAGGCGCTCCGATGA
- Drug Resistance
- Mutations
- Function
- Unknown
- Family
-
Unknown
- GO
-
- NAD(P)+ transhydrogenase activity GO:0008746 molecular_function
- plasma membrane GO:0005886 cellular_component
- NADP binding GO:0050661 molecular_function
- NAD binding GO:0051287 molecular_function
- NADPH regeneration GO:0006740 biological_process
- integral component of membrane GO:0016021 cellular_component
- InterPro
Summary
- Name
- Probable NAD(P) transhydrogenase (Subunit alpha) PntAb [second part integral membrane protein] (Pyridine nucleotide transhydrogenase subunit alpha) (Nicotinamide nucleotide transhydrogenase subunit al...
- Family
- Unknown
- Protein Sequence
-
MYNELLENLAILVLSGFVGFAVISKVPNTLHTPLMSGTNAIHGIVVLGALVVFGEIEHPSLVLQVILFVAVVFGTLNVIGGFIVTDRMLGMFKAKKPAVPAKPDRDEALR
- Mass
- 11,782 Da
- Length
- 110 Aa
Rv0156 doesn't seem to be a targeted by any drug.
Rv0156 doesn't seem to be involved in any pathway.
- Proteogenomic analysis of Mycobacterium tuberculosis by high resolution mass spectrometry.
- Mol Cell Proteomics. 2011 Dec;10(12):M111.011627. doi: 10.1074/mcp.M111.011445. Epub 2011 Oct 3.
- Deciphering the biology of Mycobacterium tuberculosis from the complete genome sequence.
- Nature. 1998 Jun 11;393(6685):537-44. doi: 10.1038/31159.