mymT
- Type
- protein_coding
- Name
- mymT
- Locus Name
-
Rv0186A
- Product
-
Metallothionein, MymT
- Functional Category
-
Virulence, detoxification, adaptation
- Location
- 218390..218551 (- strand)
- Gene Length
- 161 bp
- Nucleotides
-
ATGAGGGTGATACGAATGACGAACTACGAGGCTGGGACCTTGCTGACCTGCAGCCACGAGGGCTGTGGCTGTCGGGTTCGCATCGAAGTCCCATGCCACTGTGCTGGCGCCGGTGACGCCTACCGCTGCACCTGCGGCGACGAATTGGCCCCGGTCAAGTA
- Drug Resistance
- Mutations
- Function
- Metallothioneins are small proteins that have a high content of cysteine residues wich allow them to bind heavy metal ions through clusters of thiolate bonds. MymT binds up to seven ions of Cu(+), with a preference for four to six Cu(+) ions, in a solvent-shielded core. MymT protects M.tuberculosis from copper toxicity. {ECO:0000269|PubMed:18724363}.
- Family
-
Metallothionein superfamily
- GO
-
- response to cadmium ion GO:0046686 biological_process
- response to copper ion GO:0046688 biological_process
- response to cobalt ion GO:0032025 biological_process
- response to nickel cation GO:0010045 biological_process
- response to zinc ion GO:0010043 biological_process
- copper ion homeostasis GO:0055070 biological_process
- copper ion binding GO:0005507 molecular_function
- zinc ion binding GO:0008270 molecular_function
- InterPro
-
- Unknown
Summary
- Name
- Metallothionein (MT) (Copper-binding metallothionein) (Cu(I)-binding metallothionein) (Mycobacterial metallothionein)
- Family
- Metallothionein superfamily
- Protein Sequence
-
MRVIRMTNYEAGTLLTCSHEGCGCRVRIEVPCHCAGAGDAYRCTCGDELAPVK
- Mass
- 5,719 Da
- Length
- 53 Aa
Rv0186A doesn't seem to be a targeted by any drug.
Rv0186A doesn't seem to be involved in any pathway.
- The copper-responsive RicR regulon contributes to Mycobacterium tuberculosis virulence.
- MBio. 2014 Feb 18;5(1). pii: mBio.00876-13. doi: 10.1128/mBio.00876-13.
- A novel copper-responsive regulon in Mycobacterium tuberculosis.
- Mol Microbiol. 2011 Jan;79(1):133-48. doi: 10.1111/j.1365-2958.2010.07431.x. Epub 2010 Oct 29.
- Proteogenomic analysis of Mycobacterium tuberculosis by high resolution mass spectrometry.
- Mol Cell Proteomics. 2011 Dec;10(12):M111.011627. doi: 10.1074/mcp.M111.011445. Epub 2011 Oct 3.
- Identification of a copper-binding metallothionein in pathogenic mycobacteria.
- Nat Chem Biol. 2008 Oct;4(10):609-16. doi: 10.1038/nchembio.109. Epub 2008 Aug 24.
- Deciphering the biology of Mycobacterium tuberculosis from the complete genome sequence.
- Nature. 1998 Jun 11;393(6685):537-44. doi: 10.1038/31159.