Rv0190
- Type
- protein_coding
- Name
- Rv0190
- Locus Name
-
Rv0190
- Product
-
Conserved protein
- Functional Category
-
Conserved hypotheticals
- Location
- 221871..222161 (+ strand)
- Gene Length
- 290 bp
- Nucleotides
-
TGACAGCAGCACACGGCTACACGCAGCAAAAGGACAACTACGCCAAGCGGTTGCGTCGCGTCGAGGGGCAAGTGCGCGGCATCGCGCGAATGATCGAGGAAGACAAGTACTGCATTGACGTTCTGACCCAGATCAGCGCCGTCACCAGTGCGTTGCGGTCGGTGGCGCTGAACCTGCTGGACGAGCACCTGAGCCACTGCGTCACCCGTGCCGTGGCCGAGGGCGGTCCTGGGGCTGACGGCAAGCTGGCAGAGGCCTCGGCAGCAATCGCGCGCCTGGTTCGTTCCTGA
- Drug Resistance
- Mutations
- Function
- Under low copper conditions, represses the expression of lpqS, Rv2963, mymT, socA, socB, mmcO and its own expression. In the presence of copper, RicR dissociates from DNA, leading to the expression of the target genes. Members of the RicR regulon are important for copper resistance during infections and full virulence in a mouse model of infection. {ECO:0000269|PubMed:21166899, ECO:0000269|PubMed:24549843}.
- Family
-
CsoR family
- GO
-
- metal ion binding GO:0046872 molecular_function
- response to copper ion GO:0046688 biological_process
- transcription regulatory region sequence-specific DNA binding GO:0000976 molecular_function
- DNA-binding transcription repressor activity GO:0001217 molecular_function
- protein-DNA complex GO:0032993 cellular_component
- negative regulation of transcription, DNA-templated GO:0045892 biological_process
- cytoplasm GO:0005737 cellular_component
- InterPro
Summary
- Name
- Copper-sensing transcriptional repressor RicR (Regulated in copper repressor)
- Family
- CsoR family
- Protein Sequence
-
MTAAHGYTQQKDNYAKRLRRVEGQVRGIARMIEEDKYCIDVLTQISAVTSALRSVALNLLDEHLSHCVTRAVAEGGPGADGKLAEASAAIARLVRS
- Mass
- 10,365 Da
- Length
- 96 Aa
Rv0190 doesn't seem to be a targeted by any drug.
Rv0190 doesn't seem to be involved in any pathway.
- The copper-responsive RicR regulon contributes to Mycobacterium tuberculosis virulence.
- MBio. 2014 Feb 18;5(1). pii: mBio.00876-13. doi: 10.1128/mBio.00876-13.
- Proteogenomic analysis of Mycobacterium tuberculosis by high resolution mass spectrometry.
- Mol Cell Proteomics. 2011 Dec;10(12):M111.011627. doi: 10.1074/mcp.M111.011445. Epub 2011 Oct 3.
- Deciphering the biology of Mycobacterium tuberculosis from the complete genome sequence.
- Nature. 1998 Jun 11;393(6685):537-44. doi: 10.1038/31159.
- A novel copper-responsive regulon in Mycobacterium tuberculosis.
- Mol Microbiol. 2011 Jan;79(1):133-48. doi: 10.1111/j.1365-2958.2010.07431.x. Epub 2010 Oct 29.