esxG
- Type
- protein_coding
- Name
- esxG
- Locus Name
-
Rv0287
- Product
-
ESAT-6 like protein EsxG (conserved protein TB9.8)
- Functional Category
-
Cell wall and cell processes
- Location
- 351525..351818 (+ strand)
- Gene Length
- 293 bp
- Nucleotides
-
TGAGCCTTTTGGATGCTCATATCCCACAGTTGGTGGCCTCCCAGTCGGCGTTTGCCGCCAAGGCGGGGCTGATGCGGCACACGATCGGTCAGGCCGAGCAGGCGGCGATGTCGGCTCAGGCGTTTCACCAGGGGGAGTCGTCGGCGGCGTTTCAGGCCGCCCATGCCCGGTTTGTGGCGGCGGCCGCCAAAGTCAACACCTTGTTGGATGTCGCGCAGGCGAATCTGGGTGAGGCCGCCGGTACCTATGTGGCCGCCGATGCTGCGGCCGCGTCGACCTATACCGGGTTCTGA
- Drug Resistance
- Mutations
- Function
- EsxG, in complex with EsxH, disrupts ESCRT function and impairs host phagosome maturation, thereby promoting intracellular bacterial growth. The complex acts by interacting, via EsxH, with the host hepatocyte growth factor-regulated tyrosine kinase substrate (HGS/HRS), a component of the ESCRT machinery. EsxG stabilizes EsxH in the host cytosol. {ECO:0000269|PubMed:24204276}.
- Family
-
WXG100 family, CFP-10 subfamily
- GO
-
- pathogenesis GO:0009405 biological_process
- extracellular region GO:0005576 cellular_component
- InterPro
2KG7
- Name
- ESAT-6-like protein EsxG (Conserved protein TB9.8)
- Family
- WXG100 family, CFP-10 subfamily
- Protein Sequence
-
MSLLDAHIPQLVASQSAFAAKAGLMRHTIGQAEQAAMSAQAFHQGESSAAFQAAHARFVAAAAKVNTLLDVAQANLGEAAGTYVAADAAAASTYTGF
- Mass
- 9,778 Da
- Length
- 97 Aa
Summary
Rv0287 doesn't seem to be a targeted by any drug.
Rv0287 doesn't seem to be involved in any pathway.
- Solution structure of the Mycobacterium tuberculosis EsxG.EsxH complex: functional implications and comparisons with other M. tuberculosis Esx family complexes.
- J Biol Chem. 2011 Aug 26;286(34):29993-30002. doi: 10.1074/jbc.M111.248732. Epub 2011 Jul 5.
- Mycobacterium tuberculosis type VII secreted effector EsxH targets host ESCRT to impair trafficking.
- PLoS Pathog. 2013 Oct;9(10):e1003734. doi: 10.1371/journal.ppat.1003734. Epub 2013 Oct 31.
- Proteogenomic analysis of Mycobacterium tuberculosis by high resolution mass spectrometry.
- Mol Cell Proteomics. 2011 Dec;10(12):M111.011627. doi: 10.1074/mcp.M111.011445. Epub 2011 Oct 3.
- Stoichiometric protein complex formation and over-expression using the prokaryotic native operon structure.
- FEBS Lett. 2010 Feb 19;584(4):669-74. doi: 10.1016/j.febslet.2009.12.057. Epub 2010 Jan 18.
- Conservation of structure and protein-protein interactions mediated by the secreted mycobacterial proteins EsxA, EsxB, and EspA.
- J Bacteriol. 2010 Jan;192(1):326-35. doi: 10.1128/JB.01032-09.
- Systematic genetic nomenclature for type VII secretion systems.
- PLoS Pathog. 2009 Oct;5(10):e1000507. doi: 10.1371/journal.ppat.1000507. Epub 2009 Oct 30.
- Molecular features governing the stability and specificity of functional complex formation by Mycobacterium tuberculosis CFP-10/ESAT-6 family proteins.
- J Biol Chem. 2008 Jun 20;283(25):17681-90. doi: 10.1074/jbc.M800123200. Epub 2008 Apr 21.
- Characterisation of complex formation between members of the Mycobacterium tuberculosis complex CFP-10/ESAT-6 protein family: towards an understanding of the rules governing complex formation and thereby functional flexibility.
- FEMS Microbiol Lett. 2004 Sep 1;238(1):255-62. doi: 10.1016/j.femsle.2004.07.043.
- Deciphering the biology of Mycobacterium tuberculosis from the complete genome sequence.
- Nature. 1998 Jun 11;393(6685):537-44. doi: 10.1038/31159.