dnaJ1
- Type
- protein_coding
- Name
- dnaJ1
- Locus Name
-
Rv0352
- Product
-
Probable chaperone protein DnaJ1
- Functional Category
-
Virulence, detoxification, adaptation
- Location
- 422452..423639 (+ strand)
- Gene Length
- 1187 bp
- Nucleotides
-
TGGCCCAAAGGGAATGGGTCGAAAAAGACTTCTACCAGGAGCTGGGCGTCTCCTCTGATGCCAGTCCTGAAGAGATCAAACGTGCCTATCGGAAGTTGGCGCGCGACCTGCATCCGGACGCGAACCCGGGCAACCCGGCCGCCGGCGAACGGTTCAAGGCGGTTTCGGAGGCGCATAACGTGCTGTCGGATCCGGCCAAGCGCAAGGAGTACGACGAAACCCGCCGCCTGTTCGCCGGCGGCGGGTTCGGCGGCCGTCGGTTCGACAGCGGCTTTGGGGGCGGGTTCGGCGGTTTCGGGGTCGGTGGAGACGGCGCCGAGTTCAACCTCAACGACTTGTTCGACGCCGCCAGCCGAACCGGCGGTACCACCATCGGTGACTTGTTCGGTGGCTTGTTCGGACGCGGTGGCAGCGCCCGTCCCAGCCGCCCGCGACGCGGCAACGACCTGGAGACCGAGACCGAGTTGGATTTCGTGGAGGCCGCCAAGGGCGTGGCGATGCCGCTGCGATTAACCAGCCCGGCGCCGTGCACCAACTGCCATGGCAGCGGGGCCCGGCCAGGCACCAGCCCAAAGGTGTGTCCCACTTGCAACGGGTCGGGCGTGATCAACCGCAATCAGGGCGCGTTCGGCTTCTCCGAGCCGTGCACCGACTGCCGAGGTAGCGGCTCGATCATCGAGCACCCCTGCGAGGAGTGCAAAGGCACCGGCGTGACCACCCGCACCCGAACCATCAACGTGCGGATCCCGCCCGGTGTCGAGGATGGGCAGCGCATCCGGCTAGCCGGTCAGGGCGAGGCCGGGTTGCGCGGCGCTCCCTCGGGGGATCTCTACGTGACGGTGCATGTGCGGCCCGACAAGATCTTCGGCCGCGACGGCGACGACCTCACCGTCACCGTTCCGGTCAGCTTCACCGAATTGGCTTTGGGCTCGACGCTGTCGGTGCCTACCCTGGACGGCACGGTCGGGGTCCGGGTGCCCAAAGGCACCGCTGACGGCCGCATTCTGCGTGTGCGCGGACGCGGTGTGCCCAAGCGCAGTGGGGGTAGCGGCGACCTACTTGTCACCGTGAAGGTGGCCGTGCCGCCCAATTTGGCAGGCGCCGCTCAGGAAGCTCTGGAAGCCTATGCGGCGGCGGAGCGGTCCAGTGGTTTCAACCCGCGGGCCGGATGGGCAGGTAATCGCTGA
- Drug Resistance
- Mutations
- Function
- Participates actively in the response to hyperosmotic and heat shock by preventing the aggregation of stress-denatured proteins and by disaggregating proteins, also in an autonomous, DnaK-independent fashion. Unfolded proteins bind initially to DnaJ; upon interaction with the DnaJ-bound protein, DnaK hydrolyzes its bound ATP, resulting in the formation of a stable complex. GrpE releases ADP from DnaK; ATP binding to DnaK triggers the release of the substrate protein, thus completing the reaction cycle. Several rounds of ATP-dependent interactions between DnaJ, DnaK and GrpE are required for fully efficient folding. Also involved, together with DnaK and GrpE, in the DNA replication of plasmids through activation of initiation proteins. {ECO:0000255|HAMAP-Rule:MF_01152}.
- Family
-
DnaJ family
- GO
-
- regulation of gene expression GO:0010468 biological_process
- response to heat GO:0009408 biological_process
- positive regulation of transcription regulatory region DNA binding GO:2000679 biological_process
- heat shock protein binding GO:0031072 molecular_function
- protein refolding GO:0042026 biological_process
- cell wall GO:0005618 cellular_component
- ATP binding GO:0005524 molecular_function
- DNA replication GO:0006260 biological_process
- chaperone cofactor-dependent protein refolding GO:0051085 biological_process
- unfolded protein binding GO:0051082 molecular_function
- zinc ion binding GO:0008270 molecular_function
- cytoplasm GO:0005737 cellular_component
- plasma membrane GO:0005886 cellular_component
- InterPro
Summary
- Name
- Chaperone protein DnaJ 1
- Family
- DnaJ family
- Protein Sequence
-
MAQREWVEKDFYQELGVSSDASPEEIKRAYRKLARDLHPDANPGNPAAGERFKAVSEAHNVLSDPAKRKEYDETRRLFAGGGFGGRRFDSGFGGGFGGFGVGGDGAEFNLNDLFDAASRTGGTTIGDLFGGLFGRGGSARPSRPRRGNDLETETELDFVEAAKGVAMPLRLTSPAPCTNCHGSGARPGTSPKVCPTCNGSGVINRNQGAFGFSEPCTDCRGSGSIIEHPCEECKGTGVTTRTRTINVRIPPGVEDGQRIRLAGQGEAGLRGAPSGDLYVTVHVRPDKIFGRDGDDLTVTVPVSFTELALGSTLSVPTLDGTVGVRVPKGTADGRILRVRGRGVPKRSGGSGDLLVTVKVAVPPNLAGAAQEALEAYAAAERSSGFNPRAGWAGNR
- Mass
- 41,345 Da
- Length
- 395 Aa
Rv0352 doesn't seem to be a targeted by any drug.
Rv0352 doesn't seem to be involved in any pathway.
- Proteogenomic analysis of Mycobacterium tuberculosis by high resolution mass spectrometry.
- Mol Cell Proteomics. 2011 Dec;10(12):M111.011627. doi: 10.1074/mcp.M111.011445. Epub 2011 Oct 3.
- targetTB: a target identification pipeline for Mycobacterium tuberculosis through an interactome, reactome and genome-scale structural analysis.
- BMC Syst Biol. 2008 Dec 19;2:109. doi: 10.1186/1752-0509-2-109.
- Deciphering the biology of Mycobacterium tuberculosis from the complete genome sequence.
- Nature. 1998 Jun 11;393(6685):537-44. doi: 10.1038/31159.
- Mycobacterium species identification--a new approach via dnaJ gene sequencing.
- Syst Appl Microbiol. 2007 Sep;30(6):453-62. doi: 10.1016/j.syapm.2007.06.003. Epub 2007 Jul 20.
- A gene from Mycobacterium tuberculosis which is homologous to the DnaJ heat shock protein of E. coli.
- Nucleic Acids Res. 1988 Feb 25;16(4):1636. doi: 10.1093/nar/16.4.1636.