def
- Type
- protein_coding
- Name
- def
- Locus Name
-
Rv0429c
- Product
-
Probable polypeptide deformylase Def (PDF) (formylmethionine deformylase)
- Functional Category
-
Information pathways
- Location
- 517803..518396 (- strand)
- Gene Length
- 593 bp
- Nucleotides
-
ATGGCAGTCGTACCCATCCGCATCGTGGGCGATCCCGTCTTACACACTGCGACCACACCGGTGACGGTCGCCGCCGACGGTTCACTCCCGGCGGATCTCGCCCAGTTGATCGCCACCATGTACGACACCATGGACGCCGCCAACGGAGTCGGCCTGGCTGCCAACCAGATCGGCTGCAGCCTGCGGCTCTTCGTCTACGATTGCGCCGCGGACCGCGCAATGACCGCCCGCCGACGCGGTGTGGTCATCAATCCGGTGCTTGAGACCTCCGAAATACCTGAGACCATGCCCGACCCGGACACCGACGACGAAGGCTGTCTGTCGGTTCCCGGCGAGTCATTTCCTACCGGACGCGCGAAGTGGGCACGAGTCACCGGACTCGACGCCGATGGCAGTCCGGTCAGTATCGAGGGCACCGGCCTGTTCGCGCGGATGCTGCAGCACGAAACCGGGCACCTTGATGGATTCCTGTACCTGGACCGCCTCATCGGCCGGTACGCCCGCAACGCCAAACGGGCCGTCAAGTCACATGGCTGGGGCGTTCCCGGACTGTCGTGGCTGCCCGGCGAGGACCCCGACCCGTTCGGTCACTA
- Drug Resistance
- Mutations
- Function
- Removes the formyl group from the N-terminal Met of newly synthesized proteins. Requires at least a dipeptide for an efficient rate of reaction. N-terminal L-methionine is a prerequisite for activity but the enzyme has broad specificity at other positions (By similarity). {ECO:0000250}.
- Family
-
Polypeptide deformylase family
- GO
-
- metal ion binding GO:0046872 molecular_function
- peptide deformylase activity GO:0042586 molecular_function
- protein deacylation GO:0035601 biological_process
- peptidyl-methionine modification GO:0018206 biological_process
- translation GO:0006412 biological_process
- co-translational protein modification GO:0043686 biological_process
- N-terminal protein amino acid modification GO:0031365 biological_process
- InterPro
3E3U
- Name
- Peptide deformylase (PDF) (EC 3.5.1.88) (Polypeptide deformylase)
- Family
- Polypeptide deformylase family
- Protein Sequence
-
MAVVPIRIVGDPVLHTATTPVTVAADGSLPADLAQLIATMYDTMDAANGVGLAANQIGCSLRLFVYDCAADRAMTARRRGVVINPVLETSEIPETMPDPDTDDEGCLSVPGESFPTGRAKWARVTGLDADGSPVSIEGTGLFARMLQHETGHLDGFLYLDRLIGRYARNAKRAVKSHGWGVPGLSWLPGEDPDPFGH
- Mass
- 20,939 Da
- Length
- 197 Aa
Summary
Rv0429c doesn't seem to be a targeted by any drug.
Rv0429c doesn't seem to be involved in any pathway.
- Proteogenomic analysis of Mycobacterium tuberculosis by high resolution mass spectrometry.
- Mol Cell Proteomics. 2011 Dec;10(12):M111.011627. doi: 10.1074/mcp.M111.011445. Epub 2011 Oct 3.
- targetTB: a target identification pipeline for Mycobacterium tuberculosis through an interactome, reactome and genome-scale structural analysis.
- BMC Syst Biol. 2008 Dec 19;2:109. doi: 10.1186/1752-0509-2-109.
- Deciphering the biology of Mycobacterium tuberculosis from the complete genome sequence.
- Nature. 1998 Jun 11;393(6685):537-44. doi: 10.1038/31159.