rskA
- Type
- protein_coding
- Name
- rskA
- Locus Name
-
Rv0444c
- Product
-
Anti-sigma factor RskA (regulator of sigma K)
- Functional Category
-
Information pathways
- Location
- 533091..533789 (- strand)
- Gene Length
- 698 bp
- Nucleotides
-
ATGACTGAACATACCGATTTTGAGCTGCTCGAGCTGGCTACCCCGTATGCCCTGAACGCTGTGTCCGACGATGAACGAGCCGACATCGACCGACGGGTGGCCGCCGCGCCCTCGCCGGTAGCCGCGGCTTTCAACGACGAAGTTCGAGCCGTCCGCGAGACGATGGCCGTCGTCTCGGCGGCCACCACCGCCGAGCCGCCAGCACATCTGCGGACGGCCATCCTGGATGCGACCAAGCCCGAGGTTAGGCGCCAATCACGCTGGCGTACGGCAGCCTTTGCGTCCGCAGCGGCGATCGCTGTGGGGCTGGGGGCGTTCGGCCTGGGGGTGCTGACCCGGCCATCGCCACCCCCCACCGTGGCCGAGCAAGTTCTGACGGCGCCGGACGTACGGACGGTCTCTCGCCCACTGGGCGCCGGGACGGCCACGGTGGTGTTCTCCCGCGACCGCAACACAGGTCTGCTGGTGATGAACAATGTGGCGCCACCATCCCGGGGAACCGTGTATCAGATGTGGCTGCTGGGAGGGGCCAAAGGGCCGAGGTCGGCGGGGACGATGGGCACCGCGGCGGTGACGCCCTCGACGACGGCGACGCTGACCGATCTCGGAGCCTCGACCGCACTGGCATTCACCGTCGAACCCGGCACCGGATCACCACAGCCCACCGGTACCATCTTGGCCGAGCTGCCGCTCGGGTG
- Drug Resistance
- Mutations
- Function
- An anti-sigma factor for extracytoplasmic function (ECF) sigma factor SigK. ECF sigma factors are held in an inactive form by an anti-sigma factor until released by regulated intramembrane proteolysis (RIP). RIP occurs when an extracytoplasmic signal triggers a concerted proteolytic cascade to transmit information and elicit cellular responses. The membrane-spanning regulatory substrate protein is first cut extracytoplasmically (site-1 protease, S1P), then within the membrane itself (site-2 protease, S2P, Rip1), while cytoplasmic proteases finish degrading the regulatory protein, liberating the sigma factor. {ECO:0000269|PubMed:17064366}.
- Family
-
Anti-sigma-K factor family
- GO
-
- cell wall GO:0005618 cellular_component
- plasma membrane GO:0005886 cellular_component
- sigma factor antagonist activity GO:0016989 molecular_function
- regulation of translation GO:0006417 biological_process
- integral component of membrane GO:0016021 cellular_component
- InterPro
4NQW
- Name
- Anti-sigma-K factor RskA (Regulator of SigK) (Sigma-K anti-sigma factor RskA)
- Family
- Anti-sigma-K factor family
- Protein Sequence
-
MTEHTDFELLELATPYALNAVSDDERADIDRRVAAAPSPVAAAFNDEVRAVRETMAVVSAATTAEPPAHLRTAILDATKPEVRRQSRWRTAAFASAAAIAVGLGAFGLGVLTRPSPPPTVAEQVLTAPDVRTVSRPLGAGTATVVFSRDRNTGLLVMNNVAPPSRGTVYQMWLLGGAKGPRSAGTMGTAAVTPSTTATLTDLGASTALAFTVEPGTGSPQPTGTILAELPLG
- Mass
- 23,883 Da
- Length
- 232 Aa
Summary
Rv0444c doesn't seem to be a targeted by any drug.
Rv0444c doesn't seem to be involved in any pathway.
- Proteogenomic analysis of Mycobacterium tuberculosis by high resolution mass spectrometry.
- Mol Cell Proteomics. 2011 Dec;10(12):M111.011627. doi: 10.1074/mcp.M111.011445. Epub 2011 Oct 3.
- Over-expression and purification strategies for recombinant multi-protein oligomers: a case study of Mycobacterium tuberculosis sigma/anti-sigma factor protein complexes.
- Protein Expr Purif. 2010 Dec;74(2):223-30. doi: 10.1016/j.pep.2010.06.018. Epub 2010 Jul 1.
- Mutations in Mycobacterium tuberculosis Rv0444c, the gene encoding anti-SigK, explain high level expression of MPB70 and MPB83 in Mycobacterium bovis.
- Mol Microbiol. 2006 Dec;62(5):1251-63. doi: 10.1111/j.1365-2958.2006.05455.x. Epub 2006 Oct 25.
- Deciphering the biology of Mycobacterium tuberculosis from the complete genome sequence.
- Nature. 1998 Jun 11;393(6685):537-44. doi: 10.1038/31159.