mmpS4
- Type
- protein_coding
- Name
- mmpS4
- Locus Name
-
Rv0451c
- Product
-
Probable conserved membrane protein MmpS4
- Functional Category
-
Cell wall and cell processes
- Location
- 541488..541910 (- strand)
- Gene Length
- 422 bp
- Nucleotides
-
GTGCTAATGCGGACTTGGATTCCACTGGTCATCCTGGTGGTGGTCATCGTCGGGGGCTTCACCGTGCACCGGATCCGCGGCTTCTTCGGCTCCGAAAACCGCCCGTCGTACTCCGACACCAACCTGGAAAACAGCAAACCATTCAACCCTAAACACCTGACTTACGAGATCTTCGGACCCCCCGGAACAGTCGCCGACATTAGTTATTTCGACGTCAATTCCGAGCCGCAACGGGTCGATGGAGCGGTGCTACCGTGGTCATTGCATATCACGACAAACGACGCGGCGGTGATGGGAAATATCGTGGCACAAGGTAATAGCGACAGCATTGGCTGCCGAATCACGGTAGACGGCAAGGTCAGGGCCGAGAGGGTTTCCAACGAAGTCAACGCCTATACTTACTGCTTGGTGAAGTCCGCGTG
- Drug Resistance
- Mutations
- Function
- Part of an export system, which is required for biosynthesis and secretion of siderophores. Essential for virulence. {ECO:0000269|PubMed:23431276}.
- Family
-
MmpS family
- GO
-
- pathogenesis GO:0009405 biological_process
- integral component of membrane GO:0016021 cellular_component
- plasma membrane GO:0005886 cellular_component
- InterPro
2LW3
- Name
- Siderophore export accessory protein MmpS4 (PGB14T-X)
- Family
- MmpS family
- Protein Sequence
-
MLMRTWIPLVILVVVIVGGFTVHRIRGFFGSENRPSYSDTNLENSKPFNPKHLTYEIFGPPGTVADISYFDVNSEPQRVDGAVLPWSLHITTNDAAVMGNIVAQGNSDSIGCRITVDGKVRAERVSNEVNAYTYCLVKSA
- Mass
- 15,404 Da
- Length
- 140 Aa
Summary
Rv0451c doesn't seem to be a targeted by any drug.
Rv0451c doesn't seem to be involved in any pathway.
- Discovery of a siderophore export system essential for virulence of Mycobacterium tuberculosis.
- PLoS Pathog. 2013 Jan;9(1):e1003120. doi: 10.1371/journal.ppat.1003120. Epub 2013 Jan 31.
- Crystal structure of the transcriptional regulator Rv0678 of Mycobacterium tuberculosis.
- J Biol Chem. 2014 Jun 6;289(23):16526-40. doi: 10.1074/jbc.M113.538959. Epub 2014 Apr 15.
- Proteogenomic analysis of Mycobacterium tuberculosis by high resolution mass spectrometry.
- Mol Cell Proteomics. 2011 Dec;10(12):M111.011627. doi: 10.1074/mcp.M111.011445. Epub 2011 Oct 3.
- ideR, An essential gene in mycobacterium tuberculosis: role of IdeR in iron-dependent gene expression, iron metabolism, and oxidative stress response.
- Infect Immun. 2002 Jul;70(7):3371-81. doi: 10.1128/iai.70.7.3371-3381.2002.
- Identification of Mycobacterium tuberculosis signal sequences that direct the export of a leaderless beta-lactamase gene product in Escherichia coli.
- Microbiology. 1998 Jun;144 ( Pt 6):1619-29. doi: 10.1099/00221287-144-6-1619.
- Deciphering the biology of Mycobacterium tuberculosis from the complete genome sequence.
- Nature. 1998 Jun 11;393(6685):537-44. doi: 10.1038/31159.