Rv0500A
- Type
- protein_coding
- Name
- Rv0500A
- Locus Name
-
Rv0500A
- Product
-
Conserved protein
- Functional Category
-
Conserved hypotheticals
- Location
- 591111..591347 (+ strand)
- Gene Length
- 236 bp
- Nucleotides
-
TGACGTCTACGAACGGGCCATCGGCGCGGGATACCGGTTTTGTTGAGGGCCAGCAGGCCAAGACACAACTTCTCACCGTGGCCGAAGTGGCGGCCCTGATGCGGGTGTCCAAGATGACGGTGTACCGGCTGGTGCACAATGGCGAACTGCCCGCGGTTCGGGTCGGGCGGTCATTCCGGGTGCATGCCAAGGCCGTCCACGACATGTTGGAGACTTCGTACTTCGACGCGGGCTAG
- Drug Resistance
- Mutations
- Function
- Unknown
- Family
-
Unknown
- GO
-
- DNA binding GO:0003677 molecular_function
- InterPro
Summary
- Name
- Putative DNA-binding protein Rv0500A
- Family
- Unknown
- Protein Sequence
-
MTSTNGPSARDTGFVEGQQAKTQLLTVAEVAALMRVSKMTVYRLVHNGELPAVRVGRSFRVHAKAVHDMLETSYFDAG
- Mass
- 8,508 Da
- Length
- 78 Aa
Rv0500A doesn't seem to be a targeted by any drug.
Rv0500A doesn't seem to be involved in any pathway.
- Proteogenomic analysis of Mycobacterium tuberculosis by high resolution mass spectrometry.
- Mol Cell Proteomics. 2011 Dec;10(12):M111.011627. doi: 10.1074/mcp.M111.011445. Epub 2011 Oct 3.
- Re-annotation of the genome sequence of Mycobacterium tuberculosis H37Rv.
- Microbiology. 2002 Oct;148(Pt 10):2967-73. doi: 10.1099/00221287-148-10-2967.
- Deciphering the biology of Mycobacterium tuberculosis from the complete genome sequence.
- Nature. 1998 Jun 11;393(6685):537-44. doi: 10.1038/31159.