Rv0504c
- Type
- protein_coding
- Name
- Rv0504c
- Locus Name
-
Rv0504c
- Product
-
Conserved protein
- Functional Category
-
Conserved hypotheticals
- Location
- 594802..595302 (- strand)
- Gene Length
- 500 bp
- Nucleotides
-
ATGACAGTTCCCGAAGAAGCCCAGACACTGATCGGCAAGCATTATCGGGCGCCGGACCACTTTCTGGTGGGGCGCGAGAAGATCCGCGAGTTCGCGGTCGCGGTCAAAGACGACCACCCGACCCACTACAGCGAGCCGGATGCCGCAGCGGCCGGTTACCCCGCGCTGGTAGCCCCGCTGACCTTCCTGGCGATCGCCGGCCGGCGCGTGCAGCTGGAGATCTTCACCAAGTTCAATATCCCGATCAACATCGCCCGGGTCTTTCATCGCGACCAGAAGTTCCGCTTCCACCGGCCGATCCTGGCCAACGACAAGCTGTACTTCGACACCTATCTTGACTCCGTCATCGAATCCCACGGCACGGTGCTCGCCGAGATCCGAAGCGAAGTTACCGACGCCGAAGGAAAGCCTGTGGTCACCAGTGTCGTCACCATGTTGGGAGAAGCGGCCCACCACGAAGCCGATGCCGATGCAACGGTGGCGGCGATTGCATCGATCTA
- Drug Resistance
- Mutations
- Function
- Unknown
- Family
-
UPF0336 family
- GO
-
- cell wall GO:0005618 cellular_component
- plasma membrane GO:0005886 cellular_component
- InterPro
Summary
- Name
- UPF0336 protein Rv0504c
- Family
- UPF0336 family
- Protein Sequence
-
MTVPEEAQTLIGKHYRAPDHFLVGREKIREFAVAVKDDHPTHYSEPDAAAAGYPALVAPLTFLAIAGRRVQLEIFTKFNIPINIARVFHRDQKFRFHRPILANDKLYFDTYLDSVIESHGTVLAEIRSEVTDAEGKPVVTSVVTMLGEAAHHEADADATVAAIASI
- Mass
- 18,360 Da
- Length
- 166 Aa
Rv0504c doesn't seem to be a targeted by any drug.
Rv0504c doesn't seem to be involved in any pathway.
- Proteogenomic analysis of Mycobacterium tuberculosis by high resolution mass spectrometry.
- Mol Cell Proteomics. 2011 Dec;10(12):M111.011627. doi: 10.1074/mcp.M111.011445. Epub 2011 Oct 3.
- Deciphering the biology of Mycobacterium tuberculosis from the complete genome sequence.
- Nature. 1998 Jun 11;393(6685):537-44. doi: 10.1038/31159.