mmpS2
- Type
- protein_coding
- Name
- mmpS2
- Locus Name
-
Rv0506
- Product
-
Probable conserved membrane protein MmpS2
- Functional Category
-
Cell wall and cell processes
- Location
- 596759..597202 (+ strand)
- Gene Length
- 443 bp
- Nucleotides
-
TGAGGATGATTTCGGTTAGCGGCGCCGTGAAACGCATGTGGTTGCTGCTGGCCATCGTCGTGGTGGCCGTTGTCGGGGGGCTTGGTATCTATCGGCTGCACAGCATCTTCGGTGTTCACGAGCAACCCACTGTCATGGTCAAGCCTGATTTCGACGTCCCGCTGTTCAACCCCAAGCGGGTGACCTACGAAGTCTTTGGCCCCGCCAAGACCGCAAAGATCGCCTACCTGGACCCTGATGCCCGGGTGCATCGACTCGATAGCGTGTCCCTGCCGTGGTCCGTCACGGTCGAGACGACGCTGCCCGCGGTCAGCGTCAACCTCATGGCGCAGAGTAACGCCGACGTGATCAGCTGCCGGATCATCGTCAACGGCGCCGTTAAGGACGAAAGGTCTGAGACCTCGCCGCGAGCGCTAACCTCCTGCCAGGTGTCATCCGGATGA
- Drug Resistance
- Mutations
- Function
- Unknown
- Family
-
MmpS family
- GO
-
- extracellular region GO:0005576 cellular_component
- plasma membrane GO:0005886 cellular_component
- integral component of membrane GO:0016021 cellular_component
- InterPro
Summary
- Name
- Probable transport accessory protein MmpS2
- Family
- MmpS family
- Protein Sequence
-
MISVSGAVKRMWLLLAIVVVAVVGGLGIYRLHSIFGVHEQPTVMVKPDFDVPLFNPKRVTYEVFGPAKTAKIAYLDPDARVHRLDSVSLPWSVTVETTLPAVSVNLMAQSNADVISCRIIVNGAVKDERSETSPRALTSCQVSSG
- Mass
- 15,676 Da
- Length
- 145 Aa
Rv0506 doesn't seem to be a targeted by any drug.
Rv0506 doesn't seem to be involved in any pathway.
- Crystal structure of the transcriptional regulator Rv0678 of Mycobacterium tuberculosis.
- J Biol Chem. 2014 Jun 6;289(23):16526-40. doi: 10.1074/jbc.M113.538959. Epub 2014 Apr 15.
- Proteogenomic analysis of Mycobacterium tuberculosis by high resolution mass spectrometry.
- Mol Cell Proteomics. 2011 Dec;10(12):M111.011627. doi: 10.1074/mcp.M111.011445. Epub 2011 Oct 3.
- Deciphering the biology of Mycobacterium tuberculosis from the complete genome sequence.
- Nature. 1998 Jun 11;393(6685):537-44. doi: 10.1038/31159.