vapB26
- Type
- protein_coding
- Name
- vapB26
- Locus Name
-
Rv0581
- Product
-
Possible antitoxin VapB26
- Functional Category
-
Virulence, detoxification, adaptation
- Location
- 677710..677925 (+ strand)
- Gene Length
- 215 bp
- Nucleotides
-
TGGACAAGACGACGGTCTACCTGCCGGATGAACTCAAGGCGGCCGTGAAGCGCGCCGCTCGGCAGCGCGGAGTCTCCGAAGCGCAGGTAATCCGGGAGTCCATCCGGGCGGCGGTCGGCGGCGCCAAGCCGCCGCCGCGCGGGGGTCTATATGCGGGTTCGGAGCCCATCGCGCGGCGAGTCGACGAGCTGCTGGCTGGCTTCGGTGAGCGGTGA
- Drug Resistance
- Mutations
- Function
- Antitoxin component of a type II toxin-antitoxin (TA) system. Upon expression in M.smegmatis neutralizes the effect of cognate toxin VapC26. {ECO:0000269|PubMed:20011113}.
- Family
-
Unknown
- GO
-
- regulation of transcription, DNA-templated GO:0006355 biological_process
- positive regulation of growth GO:0045927 biological_process
- InterPro
5X3T
- Name
- Antitoxin VapB26
- Family
- Unknown
- Protein Sequence
-
MDKTTVYLPDELKAAVKRAARQRGVSEAQVIRESIRAAVGGAKPPPRGGLYAGSEPIARRVDELLAGFGER
- Mass
- 7,605 Da
- Length
- 71 Aa
Summary
Rv0581 doesn't seem to be a targeted by any drug.
Rv0581 doesn't seem to be involved in any pathway.
- Proteogenomic analysis of Mycobacterium tuberculosis by high resolution mass spectrometry.
- Mol Cell Proteomics. 2011 Dec;10(12):M111.011627. doi: 10.1074/mcp.M111.011445. Epub 2011 Oct 3.
- Comprehensive functional analysis of Mycobacterium tuberculosis toxin-antitoxin systems: implications for pathogenesis, stress responses, and evolution.
- PLoS Genet. 2009 Dec;5(12):e1000767. doi: 10.1371/journal.pgen.1000767. Epub 2009 Dec 11.
- Deciphering the biology of Mycobacterium tuberculosis from the complete genome sequence.
- Nature. 1998 Jun 11;393(6685):537-44. doi: 10.1038/31159.