Rv0601c
- Type
- protein_coding
- Name
- Rv0601c
- Locus Name
-
Rv0601c
- Product
-
Two component sensor kinase [first part]
- Functional Category
-
Regulatory proteins
- Location
- 698524..698994 (- strand)
- Gene Length
- 470 bp
- Nucleotides
-
ATGGCGCTCGTTCTGGCAGCAGCCGGCGCCGTCACCGTCGTCCAGTTCCGCGACGCCGCTCACGAAGCCGACCCCGATGGCGCGCTGCGCGGGCTCACCGACGACATCACCGCCGATCTGGTCCGGGAATTGGTGACCATCCTGCCGATCGTGCTCGTCATCGCCGCGGTGGCCGCCTACCTGCTCAGCCGCGCCGCGCTGCGGCCCGTCGACCGGATCCGCGCGGCGGCGCAAACACTGACCACCACGCCGCACCCCGACACCGACGCGCCGCTGCCGGTACCTCCCACCGACGACGAGATCGCTTGGCTAGCAACGACTCTCAACACCATGCTCACCCGACTGCAACGGGCCCTCGCCCACGAACAACAGTTCGTCGCCGACGCCAGCCACGAATTACGCACCCCGTTGGCACTGCTGACCACCGAACTCGAACTGCGCTGCGCCGGCCCAGACCCGCCGACCAGCTG
- Drug Resistance
- Mutations
- Function
- Member of the three-protein two-component system HK1/HK2/TcrA. HK2 transfers its phosphoryl group to TcrA. {ECO:0000269|PubMed:17434492}.
- Family
-
Unknown
- GO
-
- protein homodimerization activity GO:0042803 molecular_function
- plasma membrane GO:0005886 cellular_component
- negative regulation of phosphorelay signal transduction system GO:0070298 biological_process
- phosphorelay sensor kinase activity GO:0000155 molecular_function
- protein kinase activity GO:0004672 molecular_function
- integral component of membrane GO:0016021 cellular_component
- InterPro
Summary
- Name
- Sensor histidine kinase component HK2 (EC 2.7.13.3)
- Family
- Unknown
- Protein Sequence
-
MALVLAAAGAVTVVQFRDAAHEADPDGALRGLTDDITADLVRELVTILPIVLVIAAVAAYLLSRAALRPVDRIRAAAQTLTTTPHPDTDAPLPVPPTDDEIAWLATTLNTMLTRLQRALAHEQQFVADASHELRTPLALLTTELELRCAGPDPPTS
- Mass
- 16,595 Da
- Length
- 156 Aa
Rv0601c doesn't seem to be a targeted by any drug.
Rv0601c doesn't seem to be involved in any pathway.
- Intra- and intermolecular domain interactions among novel two-component system proteins coded by Rv0600c, Rv0601c and Rv0602c of Mycobacterium tuberculosis.
- Microbiology. 2009 Mar;155(Pt 3):772-9. doi: 10.1099/mic.0.019059-0.
- Probing the nucleotide binding and phosphorylation by the histidine kinase of a novel three-protein two-component system from Mycobacterium tuberculosis.
- FEBS Lett. 2007 May 1;581(9):1903-9. doi: 10.1016/j.febslet.2007.03.089. Epub 2007 Apr 9.
- Deciphering the biology of Mycobacterium tuberculosis from the complete genome sequence.
- Nature. 1998 Jun 11;393(6685):537-44. doi: 10.1038/31159.