tcrA
- Type
- protein_coding
- Name
- tcrA
- Locus Name
-
Rv0602c
- Product
-
Two component DNA binding transcriptional regulatory protein TcrA
- Functional Category
-
Regulatory proteins
- Location
- 699038..699799 (- strand)
- Gene Length
- 761 bp
- Nucleotides
-
GTGGCAGATGAAACGACGATGAGAGCTGGTCGCGGCCCGGGCCGGGCATGCGGCAGGGTGTCGGGTGTGCGCATCCTGGTGGTCGAGGACGAGCCCAAGATGACGGCGCTGCTGGCGCGGGCGCTGACCGAGGAGGGCCACACGGTCGACACCGTTGCCGACGGCCGCCATGCGGTGGCGGCCGTCGACGGCGGTGACTACGACGCGGTGGTGCTGGATGTGATGCTGCCCGGTATCGACGGGTTCGAGGTATGCGCGCGGCTGCGACGGCAGCGGGTGTGGACACCGGTGCTGATGCTTACCGCCCGCGGCGCGGTCACCGACCGCATCGCGGGCCTAGACGGCGGCGCCGACGATTACCTCACCAAACCGTTCAACCTCGACGAACTGTTCGCCCGGTTGCGCGCGCTGTCACGGCGCGGGCCCATCCCACGCCCACCGACGCTGGAGGCCGGCGATCTACGCCTGGACCCGAGCGAACACCGAGTCTGGCGTGCCGACACCGAAATCCGGCTCAGTCACAAGGAATTCACCCTGCTGGAAGCCCTGATCCGCCGTCCCGGCATCGTCCACACCCGCGCCCAGCTGCTGGAACGCTGCTGGGACGCCGCCTACGAGGCCCGCTCCAACATCGTCGACGTCTACATCCGCTACCTGCGCGACAAGATCGACCGGCCCTTCGGCGTCACCTCGCTGGAAACCATTCGCGGTGCCGGATACCGGCTGCGCAAGGACGGAGGACGGCATGCGCTCCCCCGCTG
- Drug Resistance
- Mutations
- Function
- Member of the three-protein two-component system HK1/HK2/TcrA. {ECO:0000269|PubMed:17434492}.
- Family
-
Unknown
- GO
-
- transcription regulatory region sequence-specific DNA binding GO:0000976 molecular_function
- DNA-binding transcription factor activity GO:0003700 molecular_function
- DNA-binding transcription activator activity GO:0001216 molecular_function
- protein-DNA complex GO:0032993 cellular_component
- cytosol GO:0005829 cellular_component
- plasma membrane GO:0005886 cellular_component
- negative regulation of phosphorelay signal transduction system GO:0070298 biological_process
- phosphorelay response regulator activity GO:0000156 molecular_function
- InterPro
Summary
- Name
- Transcriptional regulatory protein TcrA
- Family
- Unknown
- Protein Sequence
-
MADETTMRAGRGPGRACGRVSGVRILVVEDEPKMTALLARALTEEGHTVDTVADGRHAVAAVDGGDYDAVVLDVMLPGIDGFEVCARLRRQRVWTPVLMLTARGAVTDRIAGLDGGADDYLTKPFNLDELFARLRALSRRGPIPRPPTLEAGDLRLDPSEHRVWRADTEIRLSHKEFTLLEALIRRPGIVHTRAQLLERCWDAAYEARSNIVDVYIRYLRDKIDRPFGVTSLETIRGAGYRLRKDGGRHALPR
- Mass
- 28,170 Da
- Length
- 253 Aa
Rv0602c doesn't seem to be a targeted by any drug.
Rv0602c doesn't seem to be involved in any pathway.
- Proteogenomic analysis of Mycobacterium tuberculosis by high resolution mass spectrometry.
- Mol Cell Proteomics. 2011 Dec;10(12):M111.011627. doi: 10.1074/mcp.M111.011445. Epub 2011 Oct 3.
- Intra- and intermolecular domain interactions among novel two-component system proteins coded by Rv0600c, Rv0601c and Rv0602c of Mycobacterium tuberculosis.
- Microbiology. 2009 Mar;155(Pt 3):772-9. doi: 10.1099/mic.0.019059-0.
- targetTB: a target identification pipeline for Mycobacterium tuberculosis through an interactome, reactome and genome-scale structural analysis.
- BMC Syst Biol. 2008 Dec 19;2:109. doi: 10.1186/1752-0509-2-109.
- Probing the nucleotide binding and phosphorylation by the histidine kinase of a novel three-protein two-component system from Mycobacterium tuberculosis.
- FEBS Lett. 2007 May 1;581(9):1903-9. doi: 10.1016/j.febslet.2007.03.089. Epub 2007 Apr 9.
- Deciphering the biology of Mycobacterium tuberculosis from the complete genome sequence.
- Nature. 1998 Jun 11;393(6685):537-44. doi: 10.1038/31159.