secE1
- Type
- protein_coding
- Name
- secE1
- Locus Name
-
Rv0638
- Product
-
Probable preprotein translocase SecE1
- Functional Category
-
Cell wall and cell processes
- Location
- 733737..734222 (+ strand)
- Gene Length
- 485 bp
- Nucleotides
-
TGAGCGACGAAGGCGACGTTGCCGACGAGGCCGTAGCCGACGGCGCCGAGAATGCGGACAGCCGCGGGAGCGGTGGCCGGACGGCCCTGGTGACAAAGCCGGTGGTGCGGCCGCAACGTCCCACCGGCAAGCGGTCGCGGTCGCGTGCGGCAGGAGCCGACGCAGACGTCGACGTCGAAGAGCCGTCGACCGCGGCTTCGGAAGCTACCGGGGTCGCCAAGGACGATTCGACCACCAAGGCCGTGTCGAAGGCTGCCAGGGCAAAAAAGGCCAGTAAACCGAAGGCCCGGTCGGTTAACCCGATCGCATTCGTCTACAACTACCTCAAGCAGGTCGTTGCCGAGATGCGGAAGGTAATCTGGCCGAACCGCAAACAAATGCTTACCTACACGTCGGTGGTGCTGGCGTTTCTGGCCTTCATGGTGGCGCTGGTCGCCGGTGCTGACTTGGGCCTGACCAAGCTGGTGATGTTGGTGTTCGGCTGA
- Drug Resistance
- Mutations
- Function
- Essential subunit of the Sec protein translocation channel SecYEG. Clamps together the 2 halves of SecY. May contact the channel plug during translocation. {ECO:0000255|HAMAP-Rule:MF_00422}.
- Family
-
SecE/SEC61-gamma family
- GO
-
- protein secretion GO:0009306 biological_process
- P-P-bond-hydrolysis-driven protein transmembrane transporter activity GO:0015450 molecular_function
- protein targeting GO:0006605 biological_process
- protein transport by the Sec complex GO:0043952 biological_process
- intracellular protein transmembrane transport GO:0065002 biological_process
- evasion or tolerance by symbiont of host-produced reactive oxygen species GO:0052059 biological_process
- plasma membrane GO:0005886 cellular_component
- integral component of plasma membrane GO:0005887 cellular_component
- cell wall GO:0005618 cellular_component
- InterPro
- Name
- Protein translocase subunit SecE
- Family
- SecE/SEC61-gamma family
- Protein Sequence
-
MSDEGDVADEAVADGAENADSRGSGGRTALVTKPVVRPQRPTGKRSRSRAAGADADVDVEEPSTAASEATGVAKDDSTTKAVSKAARAKKASKPKARSVNPIAFVYNYLKQVVAEMRKVIWPNRKQMLTYTSVVLAFLAFMVALVAGADLGLTKLVMLVFG
- Mass
- 16,956 Da
- Length
- 161 Aa
Rv0638 doesn't seem to be a targeted by any drug.
-
-
Tolerance of reactive oxygen produced by macrophages R-HSA-1222387
Homo sapiensR-HSA-1222387
-
-
-
Bacterial secretion system mtu03070
mtu03070Environmental Information Processing; Membrane transport
-
-
-
Protein export mtu03060
mtu03060Genetic Information Processing; Folding, sorting and degradation
-
-
-
Quorum sensing mtu02024
mtu02024Cellular Processes; Cellular community - prokaryotes
-
- Proteogenomic analysis of Mycobacterium tuberculosis by high resolution mass spectrometry.
- Mol Cell Proteomics. 2011 Dec;10(12):M111.011627. doi: 10.1074/mcp.M111.011445. Epub 2011 Oct 3.
- Deciphering the biology of Mycobacterium tuberculosis from the complete genome sequence.
- Nature. 1998 Jun 11;393(6685):537-44. doi: 10.1038/31159.