rplK
- Type
- protein_coding
- Name
- rplK
- Locus Name
-
Rv0640
- Product
-
50S ribosomal protein L11 RplK
- Functional Category
-
Information pathways
- Location
- 735022..735450 (+ strand)
- Gene Length
- 428 bp
- Nucleotides
-
TGGCCCCGAAGAAGAAGGTCGCCGGGTTGATCAAGCTGCAGATCGTGGCGGGCCAGGCCAACCCTGCCCCGCCAGTGGGCCCCGCGCTCGGTCAGCACGGCGTCAACATCATGGAGTTCTGCAAGGCGTACAACGCCGCGACGGAGAACCAGCGCGGCAACGTCATCCCGGTGGAGATCACCGTTTATGAAGACCGTAGCTTCACTTTCACGCTGAAGACGCCGCCCGCCGCCAAGCTGCTGCTTAAGGCCGCTGGTGTGGCGAAGGGTTCGGCGGAGCCGCACAAGACCAAGGTCGCCAAAGTCACCTGGGATCAAGTCCGCGAAATCGCCGAGACCAAGAAGACGGACCTCAACGCCAACGACGTCGACGCTGCGGCCAAGATCATCGCCGGTACCGCTCGGTCGATGGGCATCACCGTCGAATAG
- Drug Resistance
- Mutations
- Function
- Forms part of the ribosomal stalk which helps the ribosome interact with GTP-bound translation factors. {ECO:0000255|HAMAP-Rule:MF_00736}.
- Family
-
Universal ribosomal protein uL11 family
- GO
-
- cytosolic large ribosomal subunit GO:0022625 cellular_component
- structural constituent of ribosome GO:0003735 molecular_function
- large ribosomal subunit GO:0015934 cellular_component
- rRNA binding GO:0019843 molecular_function
- cell wall GO:0005618 cellular_component
- large ribosomal subunit rRNA binding GO:0070180 molecular_function
- ribosomal large subunit assembly GO:0000027 biological_process
- translation GO:0006412 biological_process
- InterPro
Summary
- Name
- 50S ribosomal protein L11
- Family
- Universal ribosomal protein uL11 family
- Protein Sequence
-
MAPKKKVAGLIKLQIVAGQANPAPPVGPALGQHGVNIMEFCKAYNAATENQRGNVIPVEITVYEDRSFTFTLKTPPAAKLLLKAAGVAKGSAEPHKTKVAKVTWDQVREIAETKKTDLNANDVDAAAKIIAGTARSMGITVE
- Mass
- 15,003 Da
- Length
- 142 Aa
Rv0640 doesn't seem to be a targeted by any drug.
-
-
Ribosome mtu03010
mtu03010PATHWAY_MAP mtu03010 Ribosome
-
- Proteogenomic analysis of Mycobacterium tuberculosis by high resolution mass spectrometry.
- Mol Cell Proteomics. 2011 Dec;10(12):M111.011627. doi: 10.1074/mcp.M111.011445. Epub 2011 Oct 3.
- Prokaryotic ubiquitin-like protein (Pup) proteome of Mycobacterium tuberculosis [corrected] .
- PLoS One. 2010 Jan 6;5(1):e8589. doi: 10.1371/journal.pone.0008589.
- Deciphering the biology of Mycobacterium tuberculosis from the complete genome sequence.
- Nature. 1998 Jun 11;393(6685):537-44. doi: 10.1038/31159.