rplL
- Type
- protein_coding
- Name
- rplL
- Locus Name
-
Rv0652
- Product
-
50S ribosomal protein L7/L12 RplL (SA1)
- Functional Category
-
Information pathways
- Location
- 748849..749241 (+ strand)
- Gene Length
- 392 bp
- Nucleotides
-
TGGCAAAGCTCTCCACCGACGAACTGCTGGACGCGTTCAAGGAAATGACCCTGTTGGAGCTCTCCGACTTCGTCAAGAAGTTCGAGGAGACCTTCGAGGTCACCGCCGCCGCTCCAGTCGCCGTCGCCGCCGCCGGTGCCGCCCCGGCCGGTGCCGCCGTCGAGGCTGCCGAGGAGCAGTCCGAGTTCGACGTGATCCTTGAGGCCGCCGGCGACAAGAAGATCGGCGTCATCAAGGTGGTCCGGGAGATCGTTTCCGGCCTGGGCCTCAAGGAGGCCAAGGACCTGGTCGACGGCGCGCCCAAGCCGCTGCTGGAGAAGGTCGCCAAGGAGGCCGCCGACGAGGCCAAGGCCAAGCTGGAGGCCGCCGGCGCCACCGTCACCGTCAAGTAG
- Drug Resistance
- Mutations
- Function
- Forms part of the ribosomal stalk which helps the ribosome interact with GTP-bound translation factors. Is thus essential for accurate translation. {ECO:0000255|HAMAP-Rule:MF_00368}.
- Family
-
Bacterial ribosomal protein bL12 family
- GO
-
- cytosolic large ribosomal subunit GO:0022625 cellular_component
- translation GO:0006412 biological_process
- plasma membrane GO:0005886 cellular_component
- cytosol GO:0005829 cellular_component
- cell wall GO:0005618 cellular_component
- structural constituent of ribosome GO:0003735 molecular_function
- InterPro
Summary
- Name
- 50S ribosomal protein L7/L12
- Family
- Bacterial ribosomal protein bL12 family
- Protein Sequence
-
MAKLSTDELLDAFKEMTLLELSDFVKKFEETFEVTAAAPVAVAAAGAAPAGAAVEAAEEQSEFDVILEAAGDKKIGVIKVVREIVSGLGLKEAKDLVDGAPKPLLEKVAKEAADEAKAKLEAAGATVTVK
- Mass
- 13,440 Da
- Length
- 130 Aa
Rv0652 doesn't seem to be a targeted by any drug.
-
-
Ribosome mtu03010
mtu03010PATHWAY_MAP mtu03010 Ribosome
-
- Proteogenomic analysis of Mycobacterium tuberculosis by high resolution mass spectrometry.
- Mol Cell Proteomics. 2011 Dec;10(12):M111.011627. doi: 10.1074/mcp.M111.011445. Epub 2011 Oct 3.
- targetTB: a target identification pipeline for Mycobacterium tuberculosis through an interactome, reactome and genome-scale structural analysis.
- BMC Syst Biol. 2008 Dec 19;2:109. doi: 10.1186/1752-0509-2-109.
- Deciphering the biology of Mycobacterium tuberculosis from the complete genome sequence.
- Nature. 1998 Jun 11;393(6685):537-44. doi: 10.1038/31159.