mmpS5
- Type
- protein_coding
- Name
- mmpS5
- Locus Name
-
Rv0677c
- Product
-
Possible conserved membrane protein MmpS5
- Functional Category
-
Cell wall and cell processes
- Location
- 778477..778905 (- strand)
- Gene Length
- 428 bp
- Nucleotides
-
ATGATTGGAACTCTCAAGCGTGCCTGGATACCGCTGCTCATCCTGGTTGTGGTCGCCATCGCCGGCTTCACGGTGCAGCGGATCCGCACTTTCTTTGGTTCCGAAGGCATCTTGGTGACGCCGAAGGTCTTCGCCGATGACCCGGAGCCGTTCGACCCCAAGGTGGTGGAGTACGAAGTTTCCGGCTCCGGTAGTTACGTCAACATCAACTACCTGGACCTCGACGCCAAGCCACAGCGGATCGACGGCGCAGCCCTGCCGTGGTCGCTCACCTTGAAGACCACGGCGCCGTCCGCGGCCCCCAACATCCTCGCGCAAGGCGACGGCACTTCCATCACCTGCCGAATCACCGTCGATGGCGAAGTGAAGGACGAGCGGACCGCAACCGGCGTGGATGCCCTGACCTACTGCTTTGTGAAATCCGCATG
- Drug Resistance
- Mutations
- Function
- Part of an export system, which is required for biosynthesis and secretion of siderophores. Essential for virulence. {ECO:0000269|PubMed:23431276}.; FUNCTION: Overexpression of the system confers non-target based resistance to azoles, clofazimine and bedaquiline, via an efflux mechanism. {ECO:0000269|PubMed:18851927, ECO:0000269|PubMed:25010492}.
- Family
-
MmpS family
- GO
-
- pathogenesis GO:0009405 biological_process
- extracellular region GO:0005576 cellular_component
- plasma membrane GO:0005886 cellular_component
- integral component of membrane GO:0016021 cellular_component
- InterPro
Summary
- Name
- Siderophore export accessory protein MmpS5
- Family
- MmpS family
- Protein Sequence
-
MIGTLKRAWIPLLILVVVAIAGFTVQRIRTFFGSEGILVTPKVFADDPEPFDPKVVEYEVSGSGSYVNINYLDLDAKPQRIDGAALPWSLTLKTTAPSAAPNILAQGDGTSITCRITVDGEVKDERTATGVDALTYCFVKSA
- Mass
- 15,249 Da
- Length
- 142 Aa
Rv0677c doesn't seem to be a targeted by any drug.
Rv0677c doesn't seem to be involved in any pathway.
- Acquired resistance of Mycobacterium tuberculosis to bedaquiline.
- PLoS One. 2014 Jul 10;9(7):e102135. doi: 10.1371/journal.pone.0102135. eCollection 2014.
- Crystal structure of the transcriptional regulator Rv0678 of Mycobacterium tuberculosis.
- J Biol Chem. 2014 Jun 6;289(23):16526-40. doi: 10.1074/jbc.M113.538959. Epub 2014 Apr 15.
- Discovery of a siderophore export system essential for virulence of Mycobacterium tuberculosis.
- PLoS Pathog. 2013 Jan;9(1):e1003120. doi: 10.1371/journal.ppat.1003120. Epub 2013 Jan 31.
- Proteogenomic analysis of Mycobacterium tuberculosis by high resolution mass spectrometry.
- Mol Cell Proteomics. 2011 Dec;10(12):M111.011627. doi: 10.1074/mcp.M111.011445. Epub 2011 Oct 3.
- Azole resistance in Mycobacterium tuberculosis is mediated by the MmpS5-MmpL5 efflux system.
- Tuberculosis (Edinb). 2009 Jan;89(1):84-90. doi: 10.1016/j.tube.2008.08.003. Epub 2008 Oct 11.
- ideR, An essential gene in mycobacterium tuberculosis: role of IdeR in iron-dependent gene expression, iron metabolism, and oxidative stress response.
- Infect Immun. 2002 Jul;70(7):3371-81. doi: 10.1128/iai.70.7.3371-3381.2002.
- Deciphering the biology of Mycobacterium tuberculosis from the complete genome sequence.
- Nature. 1998 Jun 11;393(6685):537-44. doi: 10.1038/31159.