Gene - combatTB X

rpsL

Type: protein_coding
Name: rpsL
Locus Name: Rv0682
Product: 30S ribosomal protein S12 RpsL
Functional Category: Information pathways
Location: 781560..781934 (+ strand)
Gene Length: 374 bp
Nucleotides: TGCCAACCATCCAGCAGCTGGTCCGCAAGGGTCGTCGGGACAAGATCAGTAAGGTCAAGACCGCGGCTCTGAAGGGCAGCCCGCAGCGTCGTGGTGTATGCACCCGCGTGTACACCACCACTCCGAAGAAGCCGAACTCGGCGCTTCGGAAGGTTGCCCGCGTGAAGTTGACGAGTCAGGTCGAGGTCACGGCGTACATTCCCGGCGAGGGCCACAACCTGCAGGAGCACTCGATGGTGCTGGTGCGCGGCGGCCGGGTGAAGGACCTGCCTGGTGTGCGCTACAAGATCATCCGCGGTTCGCTGGATACGCAGGGTGTCAAGAACCGCAAACAGGCACGCAGCCGTTACGGCGCTAAGAAGGAGAAGGGCTGA
Drug Resistance: Check for drug resistance association at TBDREAMDB
Mutations: Check for mutants available at TARGET

Function

With S4 and S5 plays an important role in translational accuracy. {ECO:0000250}.; FUNCTION: Interacts with and stabilizes bases of the 16S rRNA that are involved in tRNA selection in the A site and with the mRNA backbone. Located at the interface of the 30S and 50S subunits, it traverses the body of the 30S subunit contacting proteins on the other side and probably holding the rRNA structure together. The combined cluster of proteins S8, S12 and S17 appears to hold together the shoulder and platform of the 30S subunit (By similarity). {ECO:0000250}.

Family

Universal ribosomal protein uS12 family

GO

response to antibiotic GO:0046677 biological_process
structural constituent of ribosome GO:0003735 molecular_function
small ribosomal subunit GO:0015935 cellular_component
rRNA binding GO:0019843 molecular_function
translation GO:0006412 biological_process
tRNA binding GO:0000049 molecular_function

InterPro

UniProt: P9WH63
GenBank: Rv0682
EnsemblBacteria: Rv0682
Mycobrowser: Rv0682

Summary

Name: 30S ribosomal protein S12
Family: Universal ribosomal protein uS12 family
Protein Sequence: MPTIQQLVRKGRRDKISKVKTAALKGSPQRRGVCTRVYTTTPKKPNSALRKVARVKLTSQVEVTAYIPGEGHNLQEHSMVLVRGGRVKDLPGVRYKIIRGSLDTQGVKNRKQARSRYGAKKEKG
Mass: 13,849 Da
Length: 124 Aa

Rv0682 doesn't seem to be a targeted by any drug.

Ribosome mtu03010
mtu03010
PATHWAY_MAP mtu03010 Ribosome

Proteogenomic analysis of Mycobacterium tuberculosis by high resolution mass spectrometry.: Mol Cell Proteomics. 2011 Dec;10(12):M111.011627. doi: 10.1074/mcp.M111.011445. Epub 2011 Oct 3.
Deciphering the biology of Mycobacterium tuberculosis from the complete genome sequence.: Nature. 1998 Jun 11;393(6685):537-44. doi: 10.1038/31159.
Streptomycin resistance in mycobacteria.: Antimicrob Agents Chemother. 1994 Feb;38(2):238-42. doi: 10.1128/aac.38.2.238.
The rpsL gene and streptomycin resistance in single and multiple drug-resistant strains of Mycobacterium tuberculosis.: Mol Microbiol. 1993 Nov;10(3):521-7.
Molecular basis of streptomycin resistance in Mycobacterium tuberculosis: alterations of the ribosomal protein S12 gene and point mutations within a functional 16S ribosomal RNA pseudoknot.: Mol Microbiol. 1993 Sep;9(6):1239-46.