Gene - combatTB X

rpsG

Type: protein_coding
Name: rpsG
Locus Name: Rv0683
Product: 30S ribosomal protein S7 RpsG
Functional Category: Information pathways
Location: 781934..782404 (+ strand)
Gene Length: 470 bp
Nucleotides: TGCCACGCAAGGGGCCCGCGCCCAAGCGTCCGTTGGTCAACGACCCGGTCTACGGATCGCAGTTGGTCACCCAGTTGGTGAACAAGGTTCTGTTGAAGGGGAAAAAATCGCTGGCCGAGCGCATTGTTTATGGTGCGCTTGAGCAAGCTCGCGACAAGACCGGCACCGATCCGGTGATCACCCTCAAGCGGGCTCTCGACAATGTCAAACCCGCCCTGGAGGTGCGCAGCCGTCGCGTCGGCGGCGCGACCTATCAGGTGCCTGTCGAGGTGCGCCCCGACCGGTCGACCACGCTGGCGCTGCGCTGGCTCGTCGGCTACTCGCGGCAACGCCGTGAGAAGACGATGATCGAGCGCCTGGCAAATGAGATCCTGGATGCCAGCAATGGCCTTGGGGCCTCCGTCAAGCGGCGTGAGGACACCCACAAGATGGCCGAGGCGAACCGAGCCTTTGCGCATTATCGCTGGTGA
Drug Resistance: Check for drug resistance association at TBDREAMDB
Mutations: Check for mutants available at TARGET

Function

One of the primary rRNA binding proteins, it binds directly to 16S rRNA where it nucleates assembly of the head domain of the 30S subunit. Is located at the subunit interface close to the decoding center, probably blocks exit of the E-site tRNA. {ECO:0000255|HAMAP-Rule:MF_00480}.

Family

Universal ribosomal protein uS7 family

GO

cytosolic small ribosomal subunit GO:0022627 cellular_component
structural constituent of ribosome GO:0003735 molecular_function
mRNA binding GO:0003729 molecular_function
rRNA binding GO:0019843 molecular_function
cell wall GO:0005618 cellular_component
cytosol GO:0005829 cellular_component
plasma membrane GO:0005886 cellular_component
ribosomal small subunit assembly GO:0000028 biological_process
translation GO:0006412 biological_process
tRNA binding GO:0000049 molecular_function

InterPro

UniProt: P9WH29
GenBank: Rv0683
EnsemblBacteria: Rv0683
Mycobrowser: Rv0683

Summary

Name: 30S ribosomal protein S7
Family: Universal ribosomal protein uS7 family
Protein Sequence: MPRKGPAPKRPLVNDPVYGSQLVTQLVNKVLLKGKKSLAERIVYGALEQARDKTGTDPVITLKRALDNVKPALEVRSRRVGGATYQVPVEVRPDRSTTLALRWLVGYSRQRREKTMIERLANEILDASNGLGASVKRREDTHKMAEANRAFAHYRW
Mass: 17,600 Da
Length: 156 Aa

Rv0683 doesn't seem to be a targeted by any drug.

Ribosome mtu03010
mtu03010
PATHWAY_MAP mtu03010 Ribosome

Proteogenomic analysis of Mycobacterium tuberculosis by high resolution mass spectrometry.: Mol Cell Proteomics. 2011 Dec;10(12):M111.011627. doi: 10.1074/mcp.M111.011445. Epub 2011 Oct 3.
The rpsL gene and streptomycin resistance in single and multiple drug-resistant strains of Mycobacterium tuberculosis.: Mol Microbiol. 1993 Nov;10(3):521-7.
Deciphering the biology of Mycobacterium tuberculosis from the complete genome sequence.: Nature. 1998 Jun 11;393(6685):537-44. doi: 10.1038/31159.