rplW
- Type
- protein_coding
- Name
- rplW
- Locus Name
-
Rv0703
- Product
-
50S ribosomal protein L23 RplW
- Functional Category
-
Information pathways
- Location
- 802133..802435 (+ strand)
- Gene Length
- 302 bp
- Nucleotides
-
TGGCGACGCTCGCTGACCCCCGCGACATCATCCTGGCCCCGGTGATCTCGGAGAAATCCTATGGGTTGCTGGATGACAACGTGTACACGTTTTTGGTGCGCCCGGATTCCAACAAGACGCAGATCAAGATCGCCGTCGAGAAGATTTTTGCCGTCAAGGTCGCATCGGTGAACACCGCGAACCGGCAGGGCAAGCGTAAACGCACCCGGACCGGATACGGCAAGCGCAAGAGCACCAAGCGCGCCATCGTCACCCTGGCGCCGGGCAGCAGGCCGATCGACCTGTTCGGGGCACCGGCCTAG
- Drug Resistance
- Mutations
- Function
- One of the early assembly proteins it binds 23S rRNA. One of the proteins that surrounds the polypeptide exit tunnel on the outside of the ribosome. Forms the main docking site for trigger factor binding to the ribosome. {ECO:0000255|HAMAP-Rule:MF_01369}.
- Family
-
Universal ribosomal protein uL23 family
- GO
-
- cytosolic large ribosomal subunit GO:0022625 cellular_component
- structural constituent of ribosome GO:0003735 molecular_function
- rRNA binding GO:0019843 molecular_function
- cytosol GO:0005829 cellular_component
- plasma membrane GO:0005886 cellular_component
- ribosomal large subunit assembly GO:0000027 biological_process
- translation GO:0006412 biological_process
- InterPro
5V7Q
- Name
- 50S ribosomal protein L23
- Family
- Universal ribosomal protein uL23 family
- Protein Sequence
-
MATLADPRDIILAPVISEKSYGLLDDNVYTFLVRPDSNKTQIKIAVEKIFAVKVASVNTANRQGKRKRTRTGYGKRKSTKRAIVTLAPGSRPIDLFGAPA
- Mass
- 10,958 Da
- Length
- 100 Aa
Summary
Rv0703 doesn't seem to be a targeted by any drug.
-
-
Ribosome mtu03010
mtu03010PATHWAY_MAP mtu03010 Ribosome
-
- Proteogenomic analysis of Mycobacterium tuberculosis by high resolution mass spectrometry.
- Mol Cell Proteomics. 2011 Dec;10(12):M111.011627. doi: 10.1074/mcp.M111.011445. Epub 2011 Oct 3.
- targetTB: a target identification pipeline for Mycobacterium tuberculosis through an interactome, reactome and genome-scale structural analysis.
- BMC Syst Biol. 2008 Dec 19;2:109. doi: 10.1186/1752-0509-2-109.
- Deciphering the biology of Mycobacterium tuberculosis from the complete genome sequence.
- Nature. 1998 Jun 11;393(6685):537-44. doi: 10.1038/31159.