rplP
- Type
- protein_coding
- Name
- rplP
- Locus Name
-
Rv0708
- Product
-
50S ribosomal protein L16 RplP
- Functional Category
-
Information pathways
- Location
- 805110..805526 (+ strand)
- Gene Length
- 416 bp
- Nucleotides
-
TGTTGATTCCCCGTAAGGTTAAACATCGCAAGCAGCACCATCCTCGCCAGCGCGGCATCGCCAGCGGCGGCACCACGGTGAACTTCGGCGACTACGGCATTCAGGCCCTTGAGCACGCCTATGTCACCAACCGGCAGATCGAATCGGCGCGTATCGCCATCAACCGGCACATCAAGCGTGGCGGCAAGGTTTGGATCAACATCTTCCCTGACCGCCCGCTGACCAAGAAGCCCGCCGAAACCCGCATGGGTTCGGGCAAGGGCTCGCCGGAGTGGTGGGTAGCCAACGTTAAGCCGGGCCGGGTGCTGTTCGAGCTCAGTTACCCCAATGAAGGTGTCGCCCGGGCCGCGCTCACCCGAGCGATCCACAAGCTGCCGATCAAGGCACGCATTATTACTCGAGAGGAGCAGTTCTGA
- Drug Resistance
- Mutations
- Function
- Binds 23S rRNA and is also seen to make contacts with the A and possibly P site tRNAs. {ECO:0000255|HAMAP-Rule:MF_01342}.
- Family
-
Universal ribosomal protein uL16 family
- GO
-
- cytosolic large ribosomal subunit GO:0022625 cellular_component
- structural constituent of ribosome GO:0003735 molecular_function
- rRNA binding GO:0019843 molecular_function
- plasma membrane GO:0005886 cellular_component
- translation GO:0006412 biological_process
- tRNA binding GO:0000049 molecular_function
- InterPro
5V7Q
- Name
- 50S ribosomal protein L16
- Family
- Universal ribosomal protein uL16 family
- Protein Sequence
-
MLIPRKVKHRKQHHPRQRGIASGGTTVNFGDYGIQALEHAYVTNRQIESARIAINRHIKRGGKVWINIFPDRPLTKKPAETRMGSGKGSPEWWVANVKPGRVLFELSYPNEGVARAALTRAIHKLPIKARIITREEQF
- Mass
- 15,692 Da
- Length
- 138 Aa
Summary
Rv0708 doesn't seem to be a targeted by any drug.
-
-
Ribosome mtu03010
mtu03010PATHWAY_MAP mtu03010 Ribosome
-
- Proteogenomic analysis of Mycobacterium tuberculosis by high resolution mass spectrometry.
- Mol Cell Proteomics. 2011 Dec;10(12):M111.011627. doi: 10.1074/mcp.M111.011445. Epub 2011 Oct 3.
- Deciphering the biology of Mycobacterium tuberculosis from the complete genome sequence.
- Nature. 1998 Jun 11;393(6685):537-44. doi: 10.1038/31159.