Gene - combatTB X

rplE

Type: protein_coding
Name: rplE
Locus Name: Rv0716
Product: 50S ribosomal protein L5 RplE
Functional Category: Information pathways
Location: 812059..812622 (+ strand)
Gene Length: 563 bp
Nucleotides: TGACCACTGCACAGAAGGTTCAGCCGCGCCTCAAGGAGCGCTACCGCAGTGAGATTCGGGATGCGCTGCGCAAGCAGTTCGGCTACGGCAATGTCATGCAGATCCCGACGGTGACGAAAGTCGTCGTCAACATGGGTGTCGGCGAGGCCGCCCGGGACGCCAAGTTGATCAACGGGGCGGTCAACGATTTGGCGCTGATCACCGGGCAGAAGCCGGAAGTCCGCCGGGCGCGCAAGTCCATCGCGCAGTTCAAATTGCGTGAGGGCATGCCGGTGGGCGTCCGAGTCACGCTGCGCGGTGACCGGATGTGGGAGTTCCTTGACCGGCTCACGTCGATCGCACTGCCACGCATCCGTGACTTCCGTGGGCTTTCGCCCAAACAGTTCGACGGTGTGGGCAACTACACCTTCGGGCTGGCCGAGCAGGCGGTATTCCACGAGGTCGACGTGGACAAGATTGACCGGGTCCGTGGCATGGACATCAACGTCGTCACTTCCGCGGCGACCGACGACGAAGGCCGAGCGCTGTTGCGGGCCCTCGGCTTTCCCTTCAAGGAGAACTGA
Drug Resistance: Check for drug resistance association at TBDREAMDB
Mutations: Check for mutants available at TARGET

Function

This is 1 of the proteins that binds and probably mediates the attachment of the 5S RNA into the large ribosomal subunit, where it forms part of the central protuberance. In the 70S ribosome it contacts protein S13 of the 30S subunit (bridge B1b), connecting the 2 subunits; this bridge is implicated in subunit movement. Contacts the P site tRNA; the 5S rRNA and some of its associated proteins might help stabilize positioning of ribosome-bound tRNAs. {ECO:0000255|HAMAP-Rule:MF_01333}.

Family

Universal ribosomal protein uL5 family

GO

cytosolic large ribosomal subunit GO:0022625 cellular_component
structural constituent of ribosome GO:0003735 molecular_function
rRNA binding GO:0019843 molecular_function
plasma membrane GO:0005886 cellular_component
ribosomal large subunit assembly GO:0000027 biological_process
translation GO:0006412 biological_process
tRNA binding GO:0000049 molecular_function

InterPro

UniProt: P9WH83
GenBank: Rv0716
EnsemblBacteria: Rv0716
Mycobrowser: Rv0716

Summary

Name: 50S ribosomal protein L5
Family: Universal ribosomal protein uL5 family
Protein Sequence: MTTAQKVQPRLKERYRSEIRDALRKQFGYGNVMQIPTVTKVVVNMGVGEAARDAKLINGAVNDLALITGQKPEVRRARKSIAQFKLREGMPVGVRVTLRGDRMWEFLDRLTSIALPRIRDFRGLSPKQFDGVGNYTFGLAEQAVFHEVDVDKIDRVRGMDINVVTSAATDDEGRALLRALGFPFKEN
Mass: 21,019 Da
Length: 187 Aa

Rv0716 doesn't seem to be a targeted by any drug.

Ribosome mtu03010
mtu03010
PATHWAY_MAP mtu03010 Ribosome

Proteogenomic analysis of Mycobacterium tuberculosis by high resolution mass spectrometry.: Mol Cell Proteomics. 2011 Dec;10(12):M111.011627. doi: 10.1074/mcp.M111.011445. Epub 2011 Oct 3.
Deciphering the biology of Mycobacterium tuberculosis from the complete genome sequence.: Nature. 1998 Jun 11;393(6685):537-44. doi: 10.1038/31159.