rpsN1
- Type
- protein_coding
- Name
- rpsN1
- Locus Name
-
Rv0717
- Product
-
30S ribosomal protein S14 RpsN1
- Functional Category
-
Information pathways
- Location
- 812627..812812 (+ strand)
- Gene Length
- 185 bp
- Nucleotides
-
TGGCGAAGAAGGCACTGGTCAACAAGGCCGCAGGCAAACCGAGGTTTGCCGTGCGCGCCTACACCCGTTGCAGCAAGTGCGGCCGCCCGCGTGCGGTCTACCGCAAGTTCGGGCTGTGCAGGATTTGCCTGCGCGAGATGGCGCACGCGGGTGAGTTGCCCGGCGTGCAGAAGAGCAGCTGGTAA
- Drug Resistance
- Mutations
- Function
- Binds 16S rRNA, required for the assembly of 30S particles and may also be responsible for determining the conformation of the 16S rRNA at the A site. {ECO:0000255|HAMAP-Rule:MF_01364}.
- Family
-
Universal ribosomal protein uS14 family, Zinc-binding uS14 subfamily
- GO
-
- structural constituent of ribosome GO:0003735 molecular_function
- rRNA binding GO:0019843 molecular_function
- ribosome GO:0005840 cellular_component
- zinc ion binding GO:0008270 molecular_function
- translation GO:0006412 biological_process
- InterPro
Summary
- Name
- 30S ribosomal protein S14 type Z
- Family
- Universal ribosomal protein uS14 family, Zinc-binding uS14 subfamily
- Protein Sequence
-
MAKKALVNKAAGKPRFAVRAYTRCSKCGRPRAVYRKFGLCRICLREMAHAGELPGVQKSSW
- Mass
- 6,825 Da
- Length
- 61 Aa
Rv0717 doesn't seem to be a targeted by any drug.
-
-
Ribosome mtu03010
mtu03010PATHWAY_MAP mtu03010 Ribosome
-
- Proteogenomic analysis of Mycobacterium tuberculosis by high resolution mass spectrometry.
- Mol Cell Proteomics. 2011 Dec;10(12):M111.011627. doi: 10.1074/mcp.M111.011445. Epub 2011 Oct 3.
- Deciphering the biology of Mycobacterium tuberculosis from the complete genome sequence.
- Nature. 1998 Jun 11;393(6685):537-44. doi: 10.1038/31159.