Gene - combatTB X

sigL

Type: protein_coding
Name: sigL
Locus Name: Rv0735
Product: Probable alternative RNA polymerase sigma factor SigL
Functional Category: Information pathways
Location: 827543..828076 (+ strand)
Gene Length: 533 bp
Nucleotides: TGGCTCGTGTGTCGGGCGCCGCGGCCGCTGAAGCCGCGTTGATGAGGGCGCTCTACGACGAGCATGCCGCCGTGTTGTGGCGTTACGCGCTGCGCTTGACCGGGGATGCGGCCCAAGCCGAAGACGTCGTCCAAGAGACGCTGTTGCGGGCGTGGCAGCATCCGGAGGTGATCGGCGACACCGCGCGGCCGGCAAGGGCGTGGTTGTTCACCGTCGCGCGCAACATGATCATCGACGAGCGGCGCAGCGCCCGGTTCCGCAATGTGGTCGGTTCGACCGACCAATCGGGCACACCCGAGCAGTCGACGCCGGACGAGGTGAACGCCGCACTGGATCGGCTGCTGATCGCCGATGCGCTGGCCCAACTGTCCGCCGAGCATAGGGCCGTGATCCAGCGGTCCTACTACCGCGGATGGTCGACCGCACAGATTGCCACCGACCTCGGAATTGCCGAAGGAACGGTGAAGTCGCGATTGCACTACGCCGTGCGCGCGTTGCGGCTCACTCTGCAGGAACTGGGAGTTACTCGATGA
Drug Resistance: Check for drug resistance association at TBDREAMDB
Mutations: Check for mutants available at TARGET

Function

Sigma factors are initiation factors that promote the attachment of RNA polymerase to specific initiation sites and are then released. Extracytoplasmic function (ECF) sigma factors are held in an inactive form by an anti-sigma factor until released by regulated intramembrane proteolysis. Over-expression of SigL induces 19-28 genes including polyketide synthases, secreted and membrane proteins. Might play a minor role in regulating SigB. {ECO:0000269|PubMed:16199577, ECO:0000269|PubMed:16552079}.

Family

Sigma-70 factor family, ECF subfamily

GO

pathogenesis GO:0009405 biological_process
DNA-binding transcription factor activity GO:0003700 molecular_function
DNA binding GO:0003677 molecular_function
DNA-templated transcription, initiation GO:0006352 biological_process
regulation of transcription, DNA-templated GO:0006355 biological_process
sigma factor activity GO:0016987 molecular_function

InterPro

UniProt: P9WGH5
GenBank: Rv0735
EnsemblBacteria: Rv0735
Mycobrowser: Rv0735

PDB IDs:

Summary

Name: ECF RNA polymerase sigma factor SigL (ECF sigma factor SigL) (Alternative RNA polymerase sigma factor SigL) (RNA polymerase sigma-L factor) (Sigma-L factor)
Family: Sigma-70 factor family, ECF subfamily
Protein Sequence: MARVSGAAAAEAALMRALYDEHAAVLWRYALRLTGDAAQAEDVVQETLLRAWQHPEVIGDTARPARAWLFTVARNMIIDERRSARFRNVVGSTDQSGTPEQSTPDEVNAALDRLLIADALAQLSAEHRAVIQRSYYRGWSTAQIATDLGIAEGTVKSRLHYAVRALRLTLQELGVTR
Mass: 19,538 Da
Length: 177 Aa

Rv0735 doesn't seem to be a targeted by any drug.

Rv0735 doesn't seem to be involved in any pathway.

Structural and biochemical bases for the redox sensitivity of Mycobacterium tuberculosis RslA.: J Mol Biol. 2010 Apr 16;397(5):1199-208. doi: 10.1016/j.jmb.2010.02.026. Epub 2010 Feb 22.
Over-expression and purification strategies for recombinant multi-protein oligomers: a case study of Mycobacterium tuberculosis sigma/anti-sigma factor protein complexes.: Protein Expr Purif. 2010 Dec;74(2):223-30. doi: 10.1016/j.pep.2010.06.018. Epub 2010 Jul 1.
Posttranslational regulation of Mycobacterium tuberculosis extracytoplasmic-function sigma factor sigma L and roles in virulence and in global regulation of gene expression.: Infect Immun. 2006 Apr;74(4):2457-61. doi: 10.1128/IAI.74.4.2457-2461.2006.
The Mycobacterium tuberculosis extracytoplasmic-function sigma factor SigL regulates polyketide synthases and secreted or membrane proteins and is required for virulence.: J Bacteriol. 2005 Oct;187(20):7062-71. doi: 10.1128/JB.187.20.7062-7071.2005.
Deciphering the biology of Mycobacterium tuberculosis from the complete genome sequence.: Nature. 1998 Jun 11;393(6685):537-44. doi: 10.1038/31159.