rslA
- Type
- protein_coding
- Name
- rslA
- Locus Name
-
Rv0736
- Product
-
Anti-sigma factor RslA
- Functional Category
-
Information pathways
- Location
- 828140..828892 (+ strand)
- Gene Length
- 752 bp
- Nucleotides
-
TGACGATGCCGCTACGAGGACTTGGCCCGCCCGATGACACCGGTGTGCGCGAGGTGTCGACGGGTGATGATCACCACTACGCGATGTGGGATGCAGCTTACGTGTTGGGAGCATTGTCTGCGGCCGACCGCCGCGAATTCGAAGCGCACCTGGCCGGTTGCCCCGAATGCCGGGGGGCCGTCACCGAACTCTGCGGGGTGCCCGCCCTGCTGTCCCAGCTCGATCGTGACGAAGTGGCCGCGATTAGCGAATCCGCCCCGACTGTGGTGGCTTCGGGGCTGTCGCCGGAGTTGTTGCCGTCGTTGCTGGCGGCGGTGCACAGGCGTCGGCGCCGTACCCGGCTGATCACCTGGGTGGCCTCGTCCGCCGCTGCCGCGGTGCTGGCGATCGGTGTGCTAGTCGGTGTGCAGGGCCACTCCGCGGCACCGCAGCGGGCGGCCGTGTCGGCGCTGCCGATGGCCCAGGTCGGCACGCAGCTGTTGGCGTCCACGGTGTCGATCAGCGGCGAGCCTTGGGGGACGTTCATCAACCTGCGGTGCGTCTGCCTGGCGCCGCCGTATGCTTCCCACGACACGCTGGCCATGGTTGTGGTGGGTCGTGACGGCAGCCAGACACGGCTGGCGACTTGGTTGGCCGAACCCGGTCACACCGCGACACCCGCCGGCAGCATTTCGACACCGGTTGACCAGATCGCCGCCGTGCAAGTGGTTGCCGCCGATACCGGCCAGGTTCTGCTGCAGCGTTCGCTCTAA
- Drug Resistance
- Mutations
- Function
- An anti-sigma factor for extracytoplasmic function (ECF) sigma factor SigL. ECF sigma factors are held in an inactive form by an anti-sigma factor until released by regulated intramembrane proteolysis (RIP). RIP occurs when an extracytoplasmic signal triggers a concerted proteolytic cascade to transmit information and elicit cellular responses. The membrane-spanning regulatory substrate protein is first cut extracytoplasmically (site-1 protease, S1P), then within the membrane itself (site-2 protease, S2P, Rip1), while cytoplasmic proteases finish degrading the regulatory protein, liberating the sigma factor. {ECO:0000269|PubMed:16552079}.
- Family
-
Zinc-associated anti-sigma factor (ZAS) superfamily
- GO
-
- pathogenesis GO:0009405 biological_process
- plasma membrane GO:0005886 cellular_component
- zinc ion binding GO:0008270 molecular_function
- sigma factor antagonist activity GO:0016989 molecular_function
- integral component of membrane GO:0016021 cellular_component
- InterPro
3HUG
- Name
- Anti-sigma-L factor RslA (Regulator of SigL) (Sigma-L anti-sigma factor RslA)
- Family
- Zinc-associated anti-sigma factor (ZAS) superfamily
- Protein Sequence
-
MTMPLRGLGPPDDTGVREVSTGDDHHYAMWDAAYVLGALSAADRREFEAHLAGCPECRGAVTELCGVPALLSQLDRDEVAAISESAPTVVASGLSPELLPSLLAAVHRRRRRTRLITWVASSAAAAVLAIGVLVGVQGHSAAPQRAAVSALPMAQVGTQLLASTVSISGEPWGTFINLRCVCLAPPYASHDTLAMVVVGRDGSQTRLATWLAEPGHTATPAGSISTPVDQIAAVQVVAADTGQVLLQRSL
- Mass
- 25,938 Da
- Length
- 250 Aa
Summary
Rv0736 doesn't seem to be a targeted by any drug.
Rv0736 doesn't seem to be involved in any pathway.
- Structural and biochemical bases for the redox sensitivity of Mycobacterium tuberculosis RslA.
- J Mol Biol. 2010 Apr 16;397(5):1199-208. doi: 10.1016/j.jmb.2010.02.026. Epub 2010 Feb 22.
- Over-expression and purification strategies for recombinant multi-protein oligomers: a case study of Mycobacterium tuberculosis sigma/anti-sigma factor protein complexes.
- Protein Expr Purif. 2010 Dec;74(2):223-30. doi: 10.1016/j.pep.2010.06.018. Epub 2010 Jul 1.
- Posttranslational regulation of Mycobacterium tuberculosis extracytoplasmic-function sigma factor sigma L and roles in virulence and in global regulation of gene expression.
- Infect Immun. 2006 Apr;74(4):2457-61. doi: 10.1128/IAI.74.4.2457-2461.2006.
- The Mycobacterium tuberculosis extracytoplasmic-function sigma factor SigL regulates polyketide synthases and secreted or membrane proteins and is required for virulence.
- J Bacteriol. 2005 Oct;187(20):7062-71. doi: 10.1128/JB.187.20.7062-7071.2005.
- Deciphering the biology of Mycobacterium tuberculosis from the complete genome sequence.
- Nature. 1998 Jun 11;393(6685):537-44. doi: 10.1038/31159.