purQ
- Type
- protein_coding
- Name
- purQ
- Locus Name
-
Rv0788
- Product
-
Probable phosphoribosylformylglycinamidine synthase I PURG (FGAM synthase I)
- Functional Category
-
Intermediary metabolism and respiration
- Location
- 882760..883434 (+ strand)
- Gene Length
- 674 bp
- Nucleotides
-
TGACGGCGCGCATCGGTGTCGTCACGTTTCCCGGCACGCTCGACGACGTCGACGCCGCGCGCGCGGCGCGGCAGGTGGGCGCCGAGGTGGTCAGCCTGTGGCATGCCGACGCCGACCTTAAGGGTGTCGACGCCGTAGTGGTGCCCGGCGGATTTTCCTACGGTGACTACCTCCGGGCCGGAGCGATCGCCAGATTCGCTCCGGTGATGGACGAAGTGGTAGCTGCCGCGGACCGCGGCATGCCGGTGTTGGGGATTTGCAACGGCTTTCAGGTGCTGTGTGAGGCCGGGCTACTACCTGGTGCCCTGACCCGCAACGTGGGATTGCACTTCATCTGCCGGGATGTGTGGCTGCGGGTAGCGTCGACGTCGACGGCGTGGACATCGCGTTTCGAGCCTGACGCCGACCTGTTGGTTCCGCTGAAGTCCGGCGAGGGCCGTTACGTGGCGCCGGAGAAGGTGCTTGACGAACTAGAAGGCGAAGGCCGGGTGGTGTTCCGCTACCATGACAACGTCAACGGCTCGCTGCGCGACATCGCCGGCATCTGCTCAGCCAACGGCCGTGTCGTCGGCCTGATGCCGCACCCCGAACATGCGATTGAAGCGTTGACCGGGCCGTCCGACGACGGACTGGGTCTGTTCTATTCAGCGCTGGATGCCGTTCTGACGGGCTGA
- Drug Resistance
- Mutations
- Function
- Part of the phosphoribosylformylglycinamidine synthase complex involved in the purines biosynthetic pathway. Catalyzes the ATP-dependent conversion of formylglycinamide ribonucleotide (FGAR) and glutamine to yield formylglycinamidine ribonucleotide (FGAM) and glutamate. The FGAM synthase complex is composed of three subunits. PurQ produces an ammonia molecule by converting glutamine to glutamate. PurL transfers the ammonia molecule to FGAR to form FGAM in an ATP-dependent manner. PurS interacts with PurQ and PurL and is thought to assist in the transfer of the ammonia molecule from PurQ to PurL. {ECO:0000255|HAMAP-Rule:MF_00421}.
- Family
-
Unknown
- GO
-
- ATP binding GO:0005524 molecular_function
- plasma membrane GO:0005886 cellular_component
- cytoplasm GO:0005737 cellular_component
- 'de novo' IMP biosynthetic process GO:0006189 biological_process
- glutamine metabolic process GO:0006541 biological_process
- glutaminase activity GO:0004359 molecular_function
- phosphoribosylformylglycinamidine synthase activity GO:0004642 molecular_function
- InterPro
Summary
- Name
- Phosphoribosylformylglycinamidine synthase subunit PurQ (FGAM synthase) (EC 6.3.5.3) (Formylglycinamide ribonucleotide amidotransferase subunit I) (FGAR amidotransferase I) (FGAR-AT I) (Glutaminase PurQ) (EC 3.5.1.2) (Phosphoribosylformylglycinamidine synthase subunit I)
- Family
- Unknown
- Protein Sequence
-
MTARIGVVTFPGTLDDVDAARAARQVGAEVVSLWHADADLKGVDAVVVPGGFSYGDYLRAGAIARFAPVMDEVVAAADRGMPVLGICNGFQVLCEAGLLPGALTRNVGLHFICRDVWLRVASTSTAWTSRFEPDADLLVPLKSGEGRYVAPEKVLDELEGEGRVVFRYHDNVNGSLRDIAGICSANGRVVGLMPHPEHAIEALTGPSDDGLGLFYSALDAVLTG
- Mass
- 23,633 Da
- Length
- 224 Aa
Rv0788 doesn't seem to be a targeted by any drug.
-
-
Purine metabolism mtu00230
mtu00230PATHWAY_MAP mtu00230 Purine metabolism
-
-
-
Arginine biosynthesis mtu00220
mtu00220PATHWAY_MAP mtu00220 Arginine biosynthesis
-
- Proteogenomic analysis of Mycobacterium tuberculosis by high resolution mass spectrometry.
- Mol Cell Proteomics. 2011 Dec;10(12):M111.011627. doi: 10.1074/mcp.M111.011445. Epub 2011 Oct 3.
- Deciphering the biology of Mycobacterium tuberculosis from the complete genome sequence.
- Nature. 1998 Jun 11;393(6685):537-44. doi: 10.1038/31159.