sseC2
- Type
- protein_coding
- Name
- sseC2
- Locus Name
-
Rv0814c
- Product
-
Conserved protein SseC2
- Functional Category
-
Intermediary metabolism and respiration
- Location
- 908181..908483 (- strand)
- Gene Length
- 302 bp
- Nucleotides
-
ATGTGCTCTGGACCCAAGCAAGGACTGACATTGCCGGCCAGCGTCGACCTGGAAAAAGAAACGGTGATCACCGGCCGCGTAGTGGACGGTGACGGCCAGGCCGTGGGCGGCGCGTTCGTGCGGCTGCTGGACTCCTCCGACGAGTTCACCGCGGAGGTCGTCGCGTCGGCCACCGGCGATTTCCGGTTCTTCGCCGCGCCCGGATCCTGGACGCTGCGCGCGCTGTCGGCGGCCGGCAACGGCGACGCGGTGGTGCAGCCCTCGGGCGCGGGCATCCACGAGGTAGACGTCAAGATCACCTG
- Drug Resistance
- Mutations
- Function
- Unknown
- Family
-
Unknown
- GO
-
- cell wall GO:0005618 cellular_component
- plasma membrane GO:0005886 cellular_component
- InterPro
Summary
- Name
- Uncharacterized protein Rv0814c
- Family
- Unknown
- Protein Sequence
-
MCSGPKQGLTLPASVDLEKETVITGRVVDGDGQAVGGAFVRLLDSSDEFTAEVVASATGDFRFFAAPGSWTLRALSAAGNGDAVVQPSGAGIHEVDVKIT
- Mass
- 10,165 Da
- Length
- 100 Aa
Rv0814c doesn't seem to be a targeted by any drug.
Rv0814c doesn't seem to be involved in any pathway.
- Proteogenomic analysis of Mycobacterium tuberculosis by high resolution mass spectrometry.
- Mol Cell Proteomics. 2011 Dec;10(12):M111.011627. doi: 10.1074/mcp.M111.011445. Epub 2011 Oct 3.
- Prokaryotic ubiquitin-like protein (Pup) proteome of Mycobacterium tuberculosis [corrected] .
- PLoS One. 2010 Jan 6;5(1):e8589. doi: 10.1371/journal.pone.0008589.
- Deciphering the biology of Mycobacterium tuberculosis from the complete genome sequence.
- Nature. 1998 Jun 11;393(6685):537-44. doi: 10.1038/31159.