kmtR
- Type
- protein_coding
- Name
- kmtR
- Locus Name
-
Rv0827c
- Product
-
Metal sensor transcriptional regulator KmtR (ArsR-SmtB family)
- Functional Category
-
Regulatory proteins
- Location
- 920741..921133 (- strand)
- Gene Length
- 392 bp
- Nucleotides
-
ATGTACGCAGATAGTGGACCTGACCCGTTGCCTGACGATCAGGTCTGCTTGGTGGTCGAGGTGTTCCGAATGCTCGCCGACGCGACCCGCGTGCAGGTGCTGTGGTCGCTGGCAGACCGCGAAATGTCGGTCAATGAACTCGCCGAGCAGGTGGGCAAGCCCGCGCCGTCGGTCTCCCAGCACCTGGCAAAGCTACGAATGGCGCGGCTGGTGCGCACCCGCCGCGATGGAACCACGATCTTTTACCGTCTGGAGAACGAGCACGTGCGCCAGCTCGTCATCGACGCCGTTTTCAACGCCGAGCACGCCGGTCCCGGGATTCCCCGCCACCACCGTGCTGCCGGCGGACTGCAGTCGGTCGCTAAGGCATCGGCTACCAAGGATGTCGGGTA
- Drug Resistance
- Mutations
- Function
- Represses expression of Rv2025c and its own expression. Acts by binding to the promoter regions. {ECO:0000269|PubMed:17726022}.
- Family
-
Unknown
- GO
-
- response to cobalt ion GO:0032025 biological_process
- response to nickel cation GO:0010045 biological_process
- DNA-binding transcription factor activity GO:0003700 molecular_function
- DNA binding GO:0003677 molecular_function
- InterPro
Summary
- Name
- HTH-type transcriptional regulator KmtR
- Family
- Unknown
- Protein Sequence
-
MYADSGPDPLPDDQVCLVVEVFRMLADATRVQVLWSLADREMSVNELAEQVGKPAPSVSQHLAKLRMARLVRTRRDGTTIFYRLENEHVRQLVIDAVFNAEHAGPGIPRHHRAAGGLQSVAKASATKDVG
- Mass
- 14,296 Da
- Length
- 130 Aa
Rv0827c doesn't seem to be a targeted by any drug.
Rv0827c doesn't seem to be involved in any pathway.
- Mycobacterial cells have dual nickel-cobalt sensors: sequence relationships and metal sites of metal-responsive repressors are not congruent.
- J Biol Chem. 2007 Nov 2;282(44):32298-310. doi: 10.1074/jbc.M703451200. Epub 2007 Aug 28.
- Deciphering the biology of Mycobacterium tuberculosis from the complete genome sequence.
- Nature. 1998 Jun 11;393(6685):537-44. doi: 10.1038/31159.