Rv0900
- Type
- protein_coding
- Name
- Rv0900
- Locus Name
-
Rv0900
- Product
-
Possible membrane protein
- Functional Category
-
Cell wall and cell processes
- Location
- 1003805..1003957 (+ strand)
- Gene Length
- 152 bp
- Nucleotides
-
TGGATTTTGTGATCCAGTGGTCGTGCTACCTGCTGGCGTTCCTGGGGGGCTCGGCTGTTGCCTGGGTAGTCGTCACTCTGTCGATCAAGCGCGCCAGCCGTGATGAGGGTGCTGCGGAGGCGCCCAGTGCAGCCGAGACAGGCGCACAGTGA
- Drug Resistance
- Mutations
- Function
- Required for wild-type expression of ArfA and ammonia secretion, not however part of an ammonia transporter. {ECO:0000269|PubMed:21410778}.
- Family
-
ArfB membrane protein family
- GO
-
- growth of symbiont in host cell GO:0044119 biological_process
- plasma membrane GO:0005886 cellular_component
- integral component of membrane GO:0016021 cellular_component
- InterPro
-
- Unknown
Summary
- Name
- Uncharacterized membrane protein ArfB
- Family
- ArfB membrane protein family
- Protein Sequence
-
MDFVIQWSCYLLAFLGGSAVAWVVVTLSIKRASRDEGAAEAPSAAETGAQ
- Mass
- 5,245 Da
- Length
- 50 Aa
Rv0900 doesn't seem to be a targeted by any drug.
Rv0900 doesn't seem to be involved in any pathway.
- Expression of the ompATb operon accelerates ammonia secretion and adaptation of Mycobacterium tuberculosis to acidic environments.
- Mol Microbiol. 2011 May;80(4):900-18. doi: 10.1111/j.1365-2958.2011.07619.x. Epub 2011 Mar 16.
- Deciphering the biology of Mycobacterium tuberculosis from the complete genome sequence.
- Nature. 1998 Jun 11;393(6685):537-44. doi: 10.1038/31159.