mku
- Type
- protein_coding
- Name
- mku
- Locus Name
-
Rv0937c
- Product
-
DNA end-binding protein, Mku
- Functional Category
-
Information pathways
- Location
- 1045199..1046020 (- strand)
- Gene Length
- 821 bp
- Nucleotides
-
ATGCGAGCCATTTGGACGGGTTCGATCGCCTTCGGGCTGGTGAACGTGCCGGTCAAGGTGTACAGCGCTACCGCAGACCACGACATCAGGTTCCACCAGGTGCACGCCAAGGACAACGGACGCATCCGGTACAAGCGCGTCTGCGAGGCGTGTGGCGAGGTGGTCGACTACCGCGATCTTGCCCGGGCCTACGAGTCCGGCGACGGCCAAATGGTGGCGATCACCGACGACGACATCGCCAGCTTGCCTGAAGAACGCAGCCGGGAGATCGAGGTGTTGGAGTTCGTCCCCGCCGCCGACGTGGACCCGATGATGTTCGACCGCAGCTACTTTTTGGAGCCTGATTCGAAGTCGTCGAAATCGTATGTGCTGCTGGCTAAGACACTCGCCGAGACCGACCGGATGGCGATCGTGCATTTCACGCTGCGCAACAAGACCAGGCTGGCGGCGTTGCGCGTCAAGGATTTCGGCAAGCGAGAGGTGATGATGGTGCACACGTTGCTGTGGCCCGATGAGATCCGCGACCCCGACTTCCCGGTGCTGGACCAGAAGGTGGAGATCAAACCCGCGGAACTCAAGATGGCCGGCCAGGTGGTGGACTCGATGGCCGACGACTTCAATCCGGACCGCTACCACGACACCTACCAGGAGCAGTTACAGGAGCTGATCGACACCAAACTCGAAGGTGGGCAGGCATTTACCGCCGAGGACCAACCGAGGTTGCTGGACGAGCCCGAAGACGTCTCCGACCTGCTCGCCAAGCTGGAGGCCAGCGTGAAGGCGCGCTCGAAGGCCAACTCAAACGTCCCAACGCCTCCGTG
- Drug Resistance
- Mutations
- Function
- With LigD forms a non-homologous end joining (NHEJ) repair enzyme. Binds linear dsDNA with 5'- and 3'-overhangs but not closed circular dsDNA nor ssDNA. One dimer binds for every 30 bp. Recruits and stimulates the ligase activity of LigD but not of T4 ligase or a human ligase complex (LIG4/XRCC4). Attenuates the 3'- to 5'-exonuclease activity of LigD. Stimulates the template-directed addition of dNTPs by LigD on 5'-overhangs and nuclease activity on 3'-overhangs. {ECO:0000269|PubMed:12215643, ECO:0000269|PubMed:15499016, ECO:0000269|PubMed:15778718, ECO:0000269|PubMed:16023671}.
- Family
-
Prokaryotic Ku family
- GO
-
- double-stranded DNA binding GO:0003690 molecular_function
- DNA recombination GO:0006310 biological_process
- double-strand break repair via nonhomologous end joining GO:0006303 biological_process
- positive regulation of ligase activity GO:0051351 biological_process
- InterPro
Summary
- Name
- Non-homologous end joining protein Ku (Mt-Ku)
- Family
- Prokaryotic Ku family
- Protein Sequence
-
MRAIWTGSIAFGLVNVPVKVYSATADHDIRFHQVHAKDNGRIRYKRVCEACGEVVDYRDLARAYESGDGQMVAITDDDIASLPEERSREIEVLEFVPAADVDPMMFDRSYFLEPDSKSSKSYVLLAKTLAETDRMAIVHFTLRNKTRLAALRVKDFGKREVMMVHTLLWPDEIRDPDFPVLDQKVEIKPAELKMAGQVVDSMADDFNPDRYHDTYQEQLQELIDTKLEGGQAFTAEDQPRLLDEPEDVSDLLAKLEASVKARSKANSNVPTPP
- Mass
- 30,904 Da
- Length
- 273 Aa
Rv0937c doesn't seem to be a targeted by any drug.
Rv0937c doesn't seem to be involved in any pathway.
- A Sir2-like protein participates in mycobacterial NHEJ.
- PLoS One. 2011;6(5):e20045. doi: 10.1371/journal.pone.0020045. Epub 2011 May 26.
- Proteogenomic analysis of Mycobacterium tuberculosis by high resolution mass spectrometry.
- Mol Cell Proteomics. 2011 Dec;10(12):M111.011627. doi: 10.1074/mcp.M111.011445. Epub 2011 Oct 3.
- Domain structure of a NHEJ DNA repair ligase from Mycobacterium tuberculosis.
- J Mol Biol. 2005 Aug 19;351(3):531-44. doi: 10.1016/j.jmb.2005.06.038.
- Mechanism of nonhomologous end-joining in mycobacteria: a low-fidelity repair system driven by Ku, ligase D and ligase C.
- Nat Struct Mol Biol. 2005 Apr;12(4):304-12. doi: 10.1038/nsmb915. Epub 2005 Mar 20.
- Mycobacterial Ku and ligase proteins constitute a two-component NHEJ repair machine.
- Science. 2004 Oct 22;306(5696):683-5. doi: 10.1126/science.1099824.
- Identification of a DNA nonhomologous end-joining complex in bacteria.
- Science. 2002 Sep 6;297(5587):1686-9. doi: 10.1126/science.1074584.
- Deciphering the biology of Mycobacterium tuberculosis from the complete genome sequence.
- Nature. 1998 Jun 11;393(6685):537-44. doi: 10.1038/31159.