pth
- Type
- protein_coding
- Name
- pth
- Locus Name
-
Rv1014c
- Product
-
Probable peptidyl-tRNA hydrolase Pth
- Functional Category
-
Intermediary metabolism and respiration
- Location
- 1133333..1133908 (- strand)
- Gene Length
- 575 bp
- Nucleotides
-
ATGGCCGAGCCGTTGCTCGTGGTCGGCCTCGGCAACCCTGGAGCCAATTACGCCCGTACCCGGCACAACCTCGGGTTCGTGGTCGCCGATCTGCTCGCCGCGCGACTAGGCGCGAAGTTCAAGGCACACAAGCGTTCCGGCGCCGAAGTCGCCACTGGTAGATCAGCCGGGCGCTCCCTGGTTTTGGCCAAGCCGCGCTGCTACATGAACGAGTCCGGCCGCCAGATAGGGCCGCTGGCGAAGTTCTACTCGGTGGCGCCGGCCAACATCATCGTCATCCACGACGACCTTGACCTCGAGTTCGGCCGCATCCGGCTCAAGATCGGCGGCGGCGAAGGCGGCCACAACGGGTTGCGCTCGGTGGTGGCCGCGCTGGGTACCAAAGACTTTCAGCGGGTGCGTATCGGGATCGGCCGCCCGCCCGGCCGCAAGGACCCGGCGGCGTTTGTGTTGGAGAACTTTACCCCGGCCGAGCGCGCCGAGGTCCCCACGATCTGCGAGCAGGCCGCCGATGCCACCGAGCTGCTTATCGAACAGGGCATGGAGCCCGCACAAAACCGCGTCCACGCCTGGTA
- Drug Resistance
- Mutations
- Function
- The natural substrate for this enzyme may be peptidyl-tRNAs which drop off the ribosome during protein synthesis. {ECO:0000255|HAMAP-Rule:MF_00083}.
- Family
-
PTH family
- GO
-
- plasma membrane GO:0005886 cellular_component
- cytoplasm GO:0005737 cellular_component
- translation GO:0006412 biological_process
- aminoacyl-tRNA hydrolase activity GO:0004045 molecular_function
- InterPro
2JRC
- Name
- Peptidyl-tRNA hydrolase (PTH) (EC 3.1.1.29)
- Family
- PTH family
- Protein Sequence
-
MAEPLLVVGLGNPGANYARTRHNLGFVVADLLAARLGAKFKAHKRSGAEVATGRSAGRSLVLAKPRCYMNESGRQIGPLAKFYSVAPANIIVIHDDLDLEFGRIRLKIGGGEGGHNGLRSVVAALGTKDFQRVRIGIGRPPGRKDPAAFVLENFTPAERAEVPTICEQAADATELLIEQGMEPAQNRVHAW
- Mass
- 20,456 Da
- Length
- 191 Aa
Summary
Rv1014c doesn't seem to be a targeted by any drug.
Rv1014c doesn't seem to be involved in any pathway.
- Proteogenomic analysis of Mycobacterium tuberculosis by high resolution mass spectrometry.
- Mol Cell Proteomics. 2011 Dec;10(12):M111.011627. doi: 10.1074/mcp.M111.011445. Epub 2011 Oct 3.
- Deciphering the biology of Mycobacterium tuberculosis from the complete genome sequence.
- Nature. 1998 Jun 11;393(6685):537-44. doi: 10.1038/31159.