kdpC
- Type
- protein_coding
- Name
- kdpC
- Locus Name
-
Rv1031
- Product
-
Probable potassium-transporting ATPase C chain KdpC (potassium-translocating ATPase C chain) (ATP phosphohydrolase [potassium-transporting] C chain) (potassium binding and translocating subunit C)
- Functional Category
-
Cell wall and cell processes
- Location
- 1155853..1156422 (+ strand)
- Gene Length
- 569 bp
- Nucleotides
-
TGCGTCGTCAATTACTGCCCGCGCTCACCATGCTGTTGGTGTTCACCGTCATCACCGGCATCGTCTACCCGCTTGCCGTGACCGGCGTCGGGCAACTGTTCTTCGGTGACCAGGCGAACGGCGCGCTGCTCGAGCGGGACGGGCAGGTCATCGGCTCCGCCCACATCGGCCAGCAGTTCACCGCCGCGAAGTACTTCCACCCGCGCCCCTCGTCGGCAGGCGACGGTTACGACGCTGCGGCGAGCTCGGGCTCCAACCTGGGACCGACGAACGAGAAGCTGCTGGCGGCCGTCGCTGAACGGGTCACCGCCTACCGCAAGGAAAACAATCTGCCGGCCGATACGCTGGTTCCGGTCGACGCGGTTACCGGCTCGGGTTCCGGGCTGGACCCGGCCATATCGGTGGTCAATGCCAAGCTGCAGGCACCGCGGGTGGCGCAGGCGCGCAATATCTCGATAAGGCAGGTCGAGCGTCTGATCGAGGACCACACCGACGCGCGTGGTCTCGGCTTCCTGGGCGAGCGCGCGGTGAACGTGCTCAGGCTGAACCTCGCATTGGATCGCCTCTGA
- Drug Resistance
- Mutations
- Function
- Part of the high-affinity ATP-driven potassium transport (or Kdp) system, which catalyzes the hydrolysis of ATP coupled with the electrogenic transport of potassium into the cytoplasm. This subunit acts as a catalytic chaperone that increases the ATP-binding affinity of the ATP-hydrolyzing subunit KdpB by the formation of a transient KdpB/KdpC/ATP ternary complex. {ECO:0000255|HAMAP-Rule:MF_00276}.
- Family
-
KdpC family
- GO
-
- potassium ion transmembrane transport GO:0071805 biological_process
- ATP binding GO:0005524 molecular_function
- integral component of plasma membrane GO:0005887 cellular_component
- potassium transmembrane transporter activity, phosphorylative mechanism GO:0008556 molecular_function
- InterPro
Summary
- Name
- Potassium-transporting ATPase KdpC subunit (ATP phosphohydrolase [potassium-transporting] C chain) (Potassium-binding and translocating subunit C) (Potassium-translocating ATPase C chain)
- Family
- KdpC family
- Protein Sequence
-
MRRQLLPALTMLLVFTVITGIVYPLAVTGVGQLFFGDQANGALLERDGQVIGSAHIGQQFTAAKYFHPRPSSAGDGYDAAASSGSNLGPTNEKLLAAVAERVTAYRKENNLPADTLVPVDAVTGSGSGLDPAISVVNAKLQAPRVAQARNISIRQVERLIEDHTDARGLGFLGERAVNVLRLNLALDRL
- Mass
- 20,028 Da
- Length
- 189 Aa
Rv1031 doesn't seem to be a targeted by any drug.
-
-
Two-component system mtu02020
mtu02020Environmental Information Processing; Signal transduction
-
- Proteogenomic analysis of Mycobacterium tuberculosis by high resolution mass spectrometry.
- Mol Cell Proteomics. 2011 Dec;10(12):M111.011627. doi: 10.1074/mcp.M111.011445. Epub 2011 Oct 3.
- Deciphering the biology of Mycobacterium tuberculosis from the complete genome sequence.
- Nature. 1998 Jun 11;393(6685):537-44. doi: 10.1038/31159.