Rv1087A
- Type
- protein_coding
- Name
- Rv1087A
- Locus Name
-
Rv1087A
- Product
-
Conserved hypothetical protein
- Functional Category
-
Cell wall and cell processes
- Location
- 1214040..1214360 (+ strand)
- Gene Length
- 320 bp
- Nucleotides
-
TGCCGTGCGTGGGCTACGGCGACCGTCGCGAATTCGTCGACGCGGTGGCCGTAGAAGCCATCTGCGAAAACCTGAATACCTCGGGGCAACCCGATCCCGACCTGGTGATCCGCACCTCGGGGGAACAACGCTTGTCCGGCCACCGAGGGCCCACTGGCGGAGTTTCGCGACGTCGACTTCTGCGCGCGCTGCGTGACTACAGTACGCCACACGCGTCGATCCCCTACGTTCCGCCGCCCTATCGAAGCGACGGGATCCACGCTTCCCGGCTGGCGGTTGAATCGGTTTTCGATGCATTGGCTGGGCGCGTCGAACTCTAA
- Drug Resistance
- Mutations
- Function
- Unknown
- Family
-
Unknown
- GO
-
- magnesium ion binding GO:0000287 molecular_function
- manganese ion binding GO:0030145 molecular_function
- cytosol GO:0005829 cellular_component
- plasma membrane GO:0005886 cellular_component
- Z-farnesyl diphosphate synthase activity GO:0033850 molecular_function
- di-trans,poly-cis-decaprenylcistransferase activity GO:0008834 molecular_function
- polyprenol biosynthetic process GO:0016094 biological_process
- polyprenyltransferase activity GO:0002094 molecular_function
- InterPro
Summary
- Name
- Uncharacterized protein
- Family
- Unknown
- Protein Sequence
-
MPCVGYGDRREFVDAVAVEAICENLNTSGQPDPDLVIRTSGEQRLSGHRGPTGGVSRRRLLRALRDYSTPHASIPYVPPPYRSDGIHASRLAVESVFDALAGRVEL
- Mass
- 11,544 Da
- Length
- 106 Aa
Rv1087A doesn't seem to be a targeted by any drug.
Rv1087A doesn't seem to be involved in any pathway.
- Deciphering the biology of Mycobacterium tuberculosis from the complete genome sequence.
- Nature. 1998 Jun 11;393(6685):537-44. doi: 10.1038/31159.