PE9
- Type
- protein_coding
- Name
- PE9
- Locus Name
-
Rv1088
- Product
-
PE family protein PE9
- Functional Category
-
Pe/ppe
- Location
- 1214513..1214947 (+ strand)
- Gene Length
- 434 bp
- Nucleotides
-
TGTCATACATGATTGCCACACCAGCGGCGTTGACGGCGGCGGCAACGGATATCGACGGGATTGGCTCGGCGGTTAGCGTTGCGAACGCCGCGGCGGTCGCCGCGACAACCGGAGTGCTGGCCGCCGGTGGCGATGAAGTGTTGGCGGCCATCGCTAGGCTGTTCAACGCAAACGCCGAGGAATATCACGCCCTCAGCGCGCAGGTGGCGGCGTTTCAAACCCTGTTTGTGCGCACCTTGACTGGGGGGTGCGGAGTCTTTCGCCGGCGCCGAGGCCGCCAATGCGTCACAGCTGCAGAGCATCGCGCGGCAGGTGCGGGGCGCCGTCAACGCCGTCGCCGGTCAGGTGACGGGCAATGGCGGCTCCGGCAACAGCGGCACTTCGGCTGCGGCGGCCAACCCGAATTCCGACAACACAGCGAGCATCGCCGATAG
- Drug Resistance
- Mutations
- Function
- Together with PE10, induces macrophage apoptosis through human Toll-like receptor 4 (TLR4) signaling pathway. Interaction with TLR4 leads to increased levels of phospho-IRF-3, increase in the transcript levels of IFN-beta and pro-apoptotic genes, up-regulation of IL-10, down-regulation of IL-1b and enhanced levels of macrophage apoptosis. {ECO:0000269|PubMed:26031846}.
- Family
-
Mycobacterial PE family
- GO
-
- cell surface GO:0009986 cellular_component
- pathogenesis GO:0009405 biological_process
- cell wall GO:0005618 cellular_component
- extracellular region GO:0005576 cellular_component
- plasma membrane GO:0005886 cellular_component
- InterPro
Summary
- Name
- PE family protein PE9
- Family
- Mycobacterial PE family
- Protein Sequence
-
MSYMIATPAALTAAATDIDGIGSAVSVANAAAVAATTGVLAAGGDEVLAAIARLFNANAEEYHALSAQVAAFQTLFVRTLTGGCGVFRRRRGRQCVTAAEHRAAGAGRRQRRRRSGDGQWRLRQQRHFGCGGQPEFRQHSEHRR
- Mass
- 15,376 Da
- Length
- 144 Aa
Rv1088 doesn't seem to be a targeted by any drug.
Rv1088 doesn't seem to be involved in any pathway.
- Mycobacterium tuberculosis PE9 protein has high activity binding peptides which inhibit target cell invasion.
- Int J Biol Macromol. 2016 May;86:646-55. doi: 10.1016/j.ijbiomac.2015.12.081. Epub 2016 Feb 2.
- The Mycobacterium tuberculosis protein pair PE9 (Rv1088)-PE10 (Rv1089) forms heterodimers and induces macrophage apoptosis through Toll-like receptor 4.
- Cell Microbiol. 2015 Nov;17(11):1653-69. doi: 10.1111/cmi.12462. Epub 2015 Jun 26.
- Deciphering the biology of Mycobacterium tuberculosis from the complete genome sequence.
- Nature. 1998 Jun 11;393(6685):537-44. doi: 10.1038/31159.