mazF3
- Type
- protein_coding
- Name
- mazF3
- Locus Name
-
Rv1102c
- Product
-
Toxin MazF3
- Functional Category
-
Virulence, detoxification, adaptation
- Location
- 1230660..1230971 (- strand)
- Gene Length
- 311 bp
- Nucleotides
-
ATGCGACCTATCCACATCGCACAGCTTGACAAGGCTAGACCCGTCCTGATCCTTACCCGCGAGGTCGTACGTCCGCACCTCACGAACGTCACCGTCGCCCCGATCACGACAACCGTGCGTGGGCTAGCCACCGAAGTCCCGGTAGACGCGGTGAACGGGCTGAATCAACCGTCAGTCGTCAGCTGCGACAACACCCAAACGATCCCGGTGTGTGACCTTGGTCGTCAAATCGGCTACCTGCTCGCGTCGCAGGAGCCGGCTCTAGCCGAGGCCATCGGCAACGCGTTCGACCTCGATTGGGTGGTGGCATA
- Drug Resistance
- Mutations
- Function
- Toxic component of a type II toxin-antitoxin (TA) system. Acts as an mRNA and 23S rRNA interferase, cleaving predominantly after the first 2 Us in the sequence 5'-UUCCU-3'; in 23S rRNA only cleaves once in the ribosomal A site in dissociated but not intact ribosomes. Cleavage of 23S rRNA inhibits protein translation; the 23S rRNA region cleaved is involved in tRNA-binding in the A site, 30S and 50S subunit interaction and ribosome recycling factor association (PubMed:23650345). Upon expression in E.coli and M.smegmatis inhibits cell growth and colony formation. It dramatically increases persister cell formation in M.smegmatis upon challenge with gentamicin or kanamycin. Overexpression leads to bacteriostasis rather than bacteriocide. Its toxic effect is neutralized by coexpression with cognate antitoxin MazE3. {ECO:0000269|PubMed:16611633, ECO:0000269|PubMed:19016878, ECO:0000269|PubMed:20011113, ECO:0000269|PubMed:20705052, ECO:0000269|PubMed:23650345, ECO:0000269|PubMed:25608501}.
- Family
-
PemK/MazF family
- GO
-
- negative regulation of translation GO:0017148 biological_process
- DNA binding GO:0003677 molecular_function
- negative regulation of transcription, DNA-templated GO:0045892 biological_process
- positive regulation of growth GO:0045927 biological_process
- negative regulation of growth GO:0045926 biological_process
- mRNA catabolic process GO:0006402 biological_process
- rRNA catabolic process GO:0016075 biological_process
- endoribonuclease activity GO:0004521 molecular_function
- InterPro
5CCA
- Name
- Endoribonuclease MazF3 (EC 3.1.-.-) (23S rRNA endonuclease MazF3) (Toxin MazF3) (mRNA interferase MazF-mt6)
- Family
- PemK/MazF family
- Protein Sequence
-
MRPIHIAQLDKARPVLILTREVVRPHLTNVTVAPITTTVRGLATEVPVDAVNGLNQPSVVSCDNTQTIPVCDLGRQIGYLLASQEPALAEAIGNAFDLDWVVA
- Mass
- 11,050 Da
- Length
- 103 Aa
Summary
Rv1102c doesn't seem to be a targeted by any drug.
Rv1102c doesn't seem to be involved in any pathway.
- MazF ribonucleases promote Mycobacterium tuberculosis drug tolerance and virulence in guinea pigs.
- Nat Commun. 2015 Jan 22;6:6059. doi: 10.1038/ncomms7059.
- Mycobacterial toxin MazF-mt6 inhibits translation through cleavage of 23S rRNA at the ribosomal A site.
- Proc Natl Acad Sci U S A. 2013 May 21;110(21):8501-6. doi: 10.1073/pnas.1222031110. Epub 2013 May 6.
- Characterization of a chromosomal toxin-antitoxin, Rv1102c-Rv1103c system in Mycobacterium tuberculosis.
- Biochem Biophys Res Commun. 2010 Sep 24;400(3):293-8. doi: 10.1016/j.bbrc.2010.08.023. Epub 2010 Aug 10.
- Comprehensive functional analysis of Mycobacterium tuberculosis toxin-antitoxin systems: implications for pathogenesis, stress responses, and evolution.
- PLoS Genet. 2009 Dec;5(12):e1000767. doi: 10.1371/journal.pgen.1000767. Epub 2009 Dec 11.
- Killing activity and rescue function of genome-wide toxin-antitoxin loci of Mycobacterium tuberculosis.
- FEMS Microbiol Lett. 2009 Jan;290(1):45-53. doi: 10.1111/j.1574-6968.2008.01400.x. Epub 2008 Nov 10.
- Characterization of mRNA interferases from Mycobacterium tuberculosis.
- J Biol Chem. 2006 Jul 7;281(27):18638-43. doi: 10.1074/jbc.M512693200. Epub 2006 Apr 12.
- Deciphering the biology of Mycobacterium tuberculosis from the complete genome sequence.
- Nature. 1998 Jun 11;393(6685):537-44. doi: 10.1038/31159.