Rv1155
- Type
- protein_coding
- Name
- Rv1155
- Locus Name
-
Rv1155
- Product
-
Possible pyridoxamine 5'-phosphate oxidase (PNP/PMP oxidase) (pyridoxinephosphate oxidase) (PNPOX) (pyridoxine 5'-phosphate oxidase)
- Functional Category
-
Intermediary metabolism and respiration
- Location
- 1281429..1281872 (+ strand)
- Gene Length
- 443 bp
- Nucleotides
-
TGGCCCGCCAAGTCTTCGACGACAAGCTGTTGGCCGTAATCAGTGGAAACTCCATTGGGGTGCTGGCCACCATTAAGCACGACGGGCGCCCCCAGTTGTCCAACGTGCAATATCACTTCGACCCGCGCAAACTGCTGATACAGGTATCGATCGCCGAGCCGCGAGCCAAGACTCGCAACCTGCGTCGCGACCCACGGGCTTCGATCCTGGTCGACGCCGACGACGGATGGTCATACGCCGTTGCTGAGGGCACTGCGCAACTGACACCTCCTGCGGCGGCGCCCGATGACGACACCGTGGAGGCGCTGATTGCCTTGTATCGCAACATCGCTGGCGAGCATTCGGACTGGGACGACTACCGGCAGGCGATGGTCACCGATCGGCGTGTGTTGCTGACGCTGCCGATCTCGCACGTATACGGCCTGCCGCCCGGTATGCGCTAA
- Drug Resistance
- Mutations
- Function
- F420H(2)-dependent reductase able to catalyze the reduction of biliverdin-IXalpha to bilirubin-IXalpha in vitro. However, kinetic parameters show that it is less efficient than the biliverdin reductase Rv2074 and suggest biliverdin-IXalpha is unlikely to be the native substrate of Rv1155, which probably catalyzes the reduction of an alternative molecule in vivo (PubMed:27364382). Binds coenzyme F420, but does not bind FMN or other flavins (PubMed:25644473). Cannot use pyridoxine 5'-phosphate, pyridoxamine 5'-phosphate, pyridoxal 5'-phosphate (PLP), the anti-tuberculosis drug PA-824 or aflatoxin analogs as substrates (PubMed:25644473). {ECO:0000269|PubMed:25644473, ECO:0000269|PubMed:27364382}.
- Family
-
F420H(2)-dependent biliverdin reductase family
- GO
-
- FMN binding GO:0010181 molecular_function
- protein homodimerization activity GO:0042803 molecular_function
- vitamin B6 metabolic process GO:0042816 biological_process
- pyridoxal phosphate binding GO:0030170 molecular_function
- coenzyme F420 binding GO:0070967 molecular_function
- oxidoreductase activity, acting on the CH-CH group of donors GO:0016627 molecular_function
- InterPro
1W9A
- Name
- F420H(2)-dependent reductase Rv1155 (EC 1.-.-.-)
- Family
- F420H(2)-dependent biliverdin reductase family
- Protein Sequence
-
MARQVFDDKLLAVISGNSIGVLATIKHDGRPQLSNVQYHFDPRKLLIQVSIAEPRAKTRNLRRDPRASILVDADDGWSYAVAEGTAQLTPPAAAPDDDTVEALIALYRNIAGEHSDWDDYRQAMVTDRRVLLTLPISHVYGLPPGMR
- Mass
- 16,301 Da
- Length
- 147 Aa
Summary
Rv1155 doesn't seem to be a targeted by any drug.
Rv1155 doesn't seem to be involved in any pathway.
- Molecular insights into the binding of coenzyme F420 to the conserved protein Rv1155 from Mycobacterium tuberculosis.
- Protein Sci. 2015 May;24(5):729-40. doi: 10.1002/pro.2645. Epub 2015 Mar 10.
- Crystal structure of the conserved hypothetical protein Rv1155 from Mycobacterium tuberculosis.
- FEBS Lett. 2005 Jan 3;579(1):215-21. doi: 10.1016/j.febslet.2004.11.069.
- Structures of Mycobacterium tuberculosispyridoxine 5'-phosphate oxidase and its complexes with flavin mononucleotide and pyridoxal 5'-phosphate.
- Acta Crystallogr D Biol Crystallogr. 2005 Nov;61(Pt 11):1492-9. doi: 10.1107/S0907444905026673. Epub 2005 Oct 19.
- Rv2074 is a novel F420 H2 -dependent biliverdin reductase in Mycobacterium tuberculosis.
- Protein Sci. 2016 Sep;25(9):1692-709. doi: 10.1002/pro.2975. Epub 2016 Jul 17.
- Proteogenomic analysis of Mycobacterium tuberculosis by high resolution mass spectrometry.
- Mol Cell Proteomics. 2011 Dec;10(12):M111.011627. doi: 10.1074/mcp.M111.011445. Epub 2011 Oct 3.
- Deciphering the biology of Mycobacterium tuberculosis from the complete genome sequence.
- Nature. 1998 Jun 11;393(6685):537-44. doi: 10.1038/31159.