fdxC
- Type
- protein_coding
- Name
- fdxC
- Locus Name
-
Rv1177
- Product
-
Probable ferredoxin FdxC
- Functional Category
-
Intermediary metabolism and respiration
- Location
- 1309005..1309331 (+ strand)
- Gene Length
- 326 bp
- Nucleotides
-
TGACGTACACGATCGCCGAACCCTGTGTCGACATCAAGGACAAGGCATGCATTGAGGAGTGCCCGGTCGATTGCATCTACGAGGGCGCCCGGATGCTGTATATCCACCCCGACGAATGCGTCGACTGTGGGGCTTGCGAGCCGGTCTGCCCCGTTGAAGCTATCTTCTACGAAGACGATGTGCCCGAACAGTGGAGCCATTACACCCAGATCAACGCCGATTTCTTCGCCGAGCTGGGATCGCCGGGCGGTGCGGCCAAGGTTGGCATGACCGAGAACGACCCGCAAGCGGTCAAGGATCTGGCGCCGCAGAGCGAGGACGCCTGA
- Drug Resistance
- Mutations
- Function
- Ferredoxins are iron-sulfur proteins that transfer electrons in a wide variety of metabolic reactions. {ECO:0000256|RuleBase:RU365098}.
- Family
-
Unknown
- GO
-
- metal ion binding GO:0046872 molecular_function
- electron transfer activity GO:0009055 molecular_function
- 4 iron, 4 sulfur cluster binding GO:0051539 molecular_function
- 3 iron, 4 sulfur cluster binding GO:0051538 molecular_function
- InterPro
Summary
- Name
- Ferredoxin
- Family
- Unknown
- Protein Sequence
-
MTYTIAEPCVDIKDKACIEECPVDCIYEGARMLYIHPDECVDCGACEPVCPVEAIFYEDDVPEQWSHYTQINADFFAELGSPGGAAKVGMTENDPQAVKDLAPQSEDA
- Mass
- 11,839 Da
- Length
- 108 Aa
Rv1177 doesn't seem to be a targeted by any drug.
Rv1177 doesn't seem to be involved in any pathway.
- Proteogenomic analysis of Mycobacterium tuberculosis by high resolution mass spectrometry.
- Mol Cell Proteomics. 2011 Dec;10(12):M111.011627. doi: 10.1074/mcp.M111.011445. Epub 2011 Oct 3.
- Deciphering the biology of Mycobacterium tuberculosis from the complete genome sequence.
- Nature. 1998 Jun 11;393(6685):537-44. doi: 10.1038/31159.