esxL
- Type
- protein_coding
- Name
- esxL
- Locus Name
-
Rv1198
- Product
-
Putative ESAT-6 like protein EsxL (ESAT-6 like protein 4)
- Functional Category
-
Cell wall and cell processes
- Location
- 1341006..1341290 (+ strand)
- Gene Length
- 284 bp
- Nucleotides
-
TGACCATCAACTATCAATTCGGGGATGTCGACGCTCACGGCGCCATGATCCGCGCTCAGGCCGGGTTGCTGGAGGCCGAGCATCAGGCCATCATTCGTGATGTGTTGACCGCGAGTGACTTTTGGGGCGGCGCCGGTTCGGCGGCCTGCCAGGGGTTCATTACCCAGTTGGGCCGTAACTTCCAGGTGATCTACGAGCAGGCCAACGCCCACGGGCAGAAGGTGCAGGCTGCCGGCAACAACATGGCGCAAACCGACAGCGCCGTCGGCTCCAGCTGGGCCTGA
- Drug Resistance
- Mutations
- Function
- Induces apoptosis of host cells. {ECO:0000269|PubMed:25242740}.
- Family
-
WXG100 family, ESAT-6 subfamily
- GO
-
- pathogenesis GO:0009405 biological_process
- cell wall GO:0005618 cellular_component
- extracellular region GO:0005576 cellular_component
- plasma membrane GO:0005886 cellular_component
- InterPro
Summary
- Name
- ESAT-6-like protein EsxL
- Family
- WXG100 family, ESAT-6 subfamily
- Protein Sequence
-
MTINYQFGDVDAHGAMIRAQAGLLEAEHQAIIRDVLTASDFWGGAGSAACQGFITQLGRNFQVIYEQANAHGQKVQAAGNNMAQTDSAVGSSWA
- Mass
- 9,928 Da
- Length
- 94 Aa
Rv1198 doesn't seem to be a targeted by any drug.
Rv1198 doesn't seem to be involved in any pathway.
- A novel firefly luciferase biosensor enhances the detection of apoptosis induced by ESAT-6 family proteins of Mycobacterium tuberculosis.
- Biochem Biophys Res Commun. 2014 Oct 3;452(4):1046-53. doi: 10.1016/j.bbrc.2014.09.047. Epub 2014 Sep 19.
- Proteogenomic analysis of Mycobacterium tuberculosis by high resolution mass spectrometry.
- Mol Cell Proteomics. 2011 Dec;10(12):M111.011627. doi: 10.1074/mcp.M111.011445. Epub 2011 Oct 3.
- Mycobacterium tuberculosis RNA Expression Patterns in Sputum Bacteria Indicate Secreted Esx Factors Contributing to Growth are Highly Expressed in Active Disease.
- Front Microbiol. 2012 Jan 10;2:266. doi: 10.3389/fmicb.2011.00266. eCollection 2011.
- Systematic genetic nomenclature for type VII secretion systems.
- PLoS Pathog. 2009 Oct;5(10):e1000507. doi: 10.1371/journal.ppat.1000507. Epub 2009 Oct 30.
- Comprehensive analysis of exported proteins from Mycobacterium tuberculosis H37Rv.
- Proteomics. 2007 May;7(10):1702-18. doi: 10.1002/pmic.200600853.
- Deciphering the biology of Mycobacterium tuberculosis from the complete genome sequence.
- Nature. 1998 Jun 11;393(6685):537-44. doi: 10.1038/31159.