Rv1205
- Type
- protein_coding
- Name
- Rv1205
- Locus Name
-
Rv1205
- Product
-
Conserved hypothetical protein
- Functional Category
-
Conserved hypotheticals
- Location
- 1348719..1349282 (+ strand)
- Gene Length
- 563 bp
- Nucleotides
-
TGTCGGCGAAAATCGACATTACCGGTGATTGGACTGTGGCCGTGTATTGCGCGGCCTCGCCAACGCACGCGGAGTTGCTAGAGCTGGCCGCCGAAGTCGGCGCGGCAATCGCCGGACGTGGCTGGACGCTGGTGTGGGGAGGTGGCCATGTTTCGGCGATGGGGGCTGTCGCCTCGGCGGCGCGAGCCTGCGGCGGCTGGACCGTCGGCGTGATTCCCAAGATGCTGGTGTACCGCGAACTGGCTGATCACGACGCCGACGAGCTAATCGTCACCGACACCATGTGGGAGCGCAAGCAGATTATGGAAGATCGCTCAGATGCGTTCATCGTGTTGCCGGGCGGTGTCGGCACCCTAGACGAGCTGTTTGACGCATGGACCGACGGGTATCTCGGTACCCATGACAAACCCATTGTGATGGTAGATCCCTGGGGGCATTTCGATGGACTGCGGGCATGGCTGAACGGATTGCTCGACACCGGTTACGTCTCACCCACGGCGATGGAACGGCTGGTGGTAGTCGATAACGTCAAGGACGCTCTGCGGGCCTGCGCACCTTCCTGA
- Drug Resistance
- Mutations
- Function
- Catalyzes the hydrolytic removal of ribose 5'-monophosphate from nitrogen N6-modified adenosines, the final step of bioactive cytokinin synthesis. Is involved in the synthesis of isopentenyladenine (iP) and 2-methylthio-iP (2MeS-iP), the most abundant cytokinins detected in M.tuberculosis lysates and supernatants. Is also able to convert trans-zeatin-riboside monophosphate (tZRMP) to trans-zeatin (tZ) in vitro; however, it may not be involved in the biosynthesis of this minor cytokinin in vivo. Accumulation of Rv1205 sensitizes M.tuberculosis to nitric oxide since cytokinin breakdown products synergize with NO to kill M.tuberculosis. Shows a slow AMP hydrolase activity, but is not able to hydrolyze ATP. Displays no lysine decarboxylase (LDC) activity (L-lysine conversion to cadaverine). {ECO:0000269|PubMed:25728768}.
- Family
-
LOG family
- GO
-
- cytokinin biosynthetic process GO:0009691 biological_process
- cytosol GO:0005829 cellular_component
- hydrolase activity, hydrolyzing N-glycosyl compounds GO:0016799 molecular_function
- InterPro
Summary
- Name
- Cytokinin riboside 5'-monophosphate phosphoribohydrolase (EC 3.2.2.n1) (Protein LONELY GUY homolog) (LOG homolog)
- Family
- LOG family
- Protein Sequence
-
MSAKIDITGDWTVAVYCAASPTHAELLELAAEVGAAIAGRGWTLVWGGGHVSAMGAVASAARACGGWTVGVIPKMLVYRELADHDADELIVTDTMWERKQIMEDRSDAFIVLPGGVGTLDELFDAWTDGYLGTHDKPIVMVDPWGHFDGLRAWLNGLLDTGYVSPTAMERLVVVDNVKDALRACAPS
- Mass
- 20,014 Da
- Length
- 187 Aa
Rv1205 doesn't seem to be a targeted by any drug.
Rv1205 doesn't seem to be involved in any pathway.
- Proteasomal control of cytokinin synthesis protects Mycobacterium tuberculosis against nitric oxide.
- Mol Cell. 2015 Mar 19;57(6):984-994. doi: 10.1016/j.molcel.2015.01.024. Epub 2015 Feb 26.
- Proteogenomic analysis of Mycobacterium tuberculosis by high resolution mass spectrometry.
- Mol Cell Proteomics. 2011 Dec;10(12):M111.011627. doi: 10.1074/mcp.M111.011445. Epub 2011 Oct 3.
- Deciphering the biology of Mycobacterium tuberculosis from the complete genome sequence.
- Nature. 1998 Jun 11;393(6685):537-44. doi: 10.1038/31159.