Rv1211
- Type
- protein_coding
- Name
- Rv1211
- Locus Name
-
Rv1211
- Product
-
Conserved protein
- Functional Category
-
Conserved hypotheticals
- Location
- 1354243..1354470 (+ strand)
- Gene Length
- 227 bp
- Nucleotides
-
TGCTCGGCGCCGACCAGGCTCGCGCAGGCGGGCCAGCCCGAATCTGGAGGGAGCACTCAATGGCGGCGATGAAGCCCCGGACCGGCGACGGTCCTTTGGAAGCAACTAAGGAGGGGCGCGGCATTGTGATGCGAGTACCACTTGAGGGTGGCGGTCGCCTGGTCGTCGAGCTGACACCCGACGAAGCCGCCGCACTGGGTGACGAACTCAAAGGCGTTACTAGCTAA
- Drug Resistance
- Mutations
- Function
- Unknown
- Family
-
Unknown
- GO
-
- regulation of NAD+ kinase activity GO:0033670 biological_process
- calcium ion binding GO:0005509 molecular_function
- regulation of hydrolase activity GO:0051336 biological_process
- InterPro
Summary
- Name
- Conserved protein
- Family
- Unknown
- Protein Sequence
-
MLGADQARAGGPARIWREHSMAAMKPRTGDGPLEATKEGRGIVMRVPLEGGGRLVVELTPDEAAALGDELKGVTS
- Mass
- 7,810 Da
- Length
- 75 Aa
Rv1211 doesn't seem to be a targeted by any drug.
Rv1211 doesn't seem to be involved in any pathway.
- Proteogenomic analysis of Mycobacterium tuberculosis by high resolution mass spectrometry.
- Mol Cell Proteomics. 2011 Dec;10(12):M111.011627. doi: 10.1074/mcp.M111.011445. Epub 2011 Oct 3.
- Deciphering the biology of Mycobacterium tuberculosis from the complete genome sequence.
- Nature. 1998 Jun 11;393(6685):537-44. doi: 10.1038/31159.