Gene - combatTB X

sigE

Type: protein_coding
Name: sigE
Locus Name: Rv1221
Product: Alternative RNA polymerase sigma factor SigE
Functional Category: Information pathways
Location: 1364413..1365186 (+ strand)
Gene Length: 773 bp
Nucleotides: TGGAACTCCTCGGCGGACCCCGGGTTGGGAATACGGAATCGCAACTTTGCGTTGCCGACGGTGACGACTTGCCAACTTATTGCAGTGCAAATTCGGAGGATCTCAATATCACGACCATCACGACCTTGAGTCCGACCAGCATGTCTCATCCCCAACAGGTCCGCGATGACCAGTGGGTGGAGCCGTCTGACCAATTGCAGGGCACCGCCGTATTCGACGCCACCGGGGACAAGGCCACCATGCCGTCCTGGGATGAGCTGGTCCGTCAGCACGCCGATCGGGTGTACCGGCTGGCTTATCGGCTCTCCGGCAACCAGCACGATGCCGAAGACCTGACCCAGGAGACCTTTATCAGGGTGTTCCGGTCGGTCCAGAATTACCAGCCGGGCACCTTCGAAGGCTGGCTACACCGCATCACCACCAACTTGTTCCTGGACATGGTCCGCCGCCGGGCTCGCATCCGGATGGAGGCGTTACCCGAGGACTACGACCGGGTGCCCGCCGATGAGCCCAACCCCGAGCAGATCTACCACGACGCACGGCTGGGACCTGACCTGCAGGCTGCCTTGGCCTCGCTGCCGCCGGAGTTTCGTGCCGCGGTGGTGCTGTGTGACATCGAGGGTCTGTCGTACGAGGAGATCGGCGCCACACTGGGCGTGAAGCTCGGGACGGTACGTAGCCGGATACACCGCGGACGCCAGGCACTGCGGGACTACCTGGCAGCGCACCCCGAACATGGCGAGTGCGCAGTTCACGTCAACCCAGTTCGCTGA
Drug Resistance: Check for drug resistance association at TBDREAMDB
Mutations: Check for mutants available at TARGET

Function

Sigma factors are initiation factors that promote the attachment of RNA polymerase to specific initiation sites and are then released. Extracytoplasmic function (ECF) sigma factors are held in an inactive form by an anti-sigma factor until released. Responds to heat shock and surface stress (detergent exposure). When combined with isolated core RNA polymerase from M.smegmatis is able to guide initiation from the sigB promoter. Required for full expression of sigB, and for sigB induction after detergent exposure but not after heat shock. Controls a regulon of about 38 genes in culture (PubMed:11489128) and about 16 genes during macrophage infection (PubMed:18657035), most of which have decreased expression in a disruption mutant. Probably down regulates the host immune response to mycobacterial infection. {ECO:0000269|PubMed:11489128, ECO:0000269|PubMed:18657035, ECO:0000269|PubMed:20025669, ECO:0000269|PubMed:9139909}.

Family

Sigma-70 factor family, ECF subfamily

GO

response to heat GO:0009408 biological_process
response to xenobiotic stimulus GO:0009410 biological_process
growth of symbiont in host cell GO:0044119 biological_process
pathogenesis GO:0009405 biological_process
DNA-binding transcription factor activity GO:0003700 molecular_function
response to hydrogen peroxide GO:0042542 biological_process
DNA binding GO:0003677 molecular_function
response to host immune response GO:0052572 biological_process
DNA-templated transcription, initiation GO:0006352 biological_process
sigma factor activity GO:0016987 molecular_function

InterPro

UniProt: P9WGG7
GenBank: Rv1221
EnsemblBacteria: Rv1221
Mycobrowser: Rv1221

Summary

Name: ECF RNA polymerase sigma factor SigE (ECF sigma factor SigE) (Alternative RNA polymerase sigma factor SigE) (RNA polymerase sigma-E factor) (Sigma-E factor)
Family: Sigma-70 factor family, ECF subfamily
Protein Sequence: MELLGGPRVGNTESQLCVADGDDLPTYCSANSEDLNITTITTLSPTSMSHPQQVRDDQWVEPSDQLQGTAVFDATGDKATMPSWDELVRQHADRVYRLAYRLSGNQHDAEDLTQETFIRVFRSVQNYQPGTFEGWLHRITTNLFLDMVRRRARIRMEALPEDYDRVPADEPNPEQIYHDARLGPDLQAALASLPPEFRAAVVLCDIEGLSYEEIGATLGVKLGTVRSRIHRGRQALRDYLAAHPEHGECAVHVNPVR
Mass: 28,877 Da
Length: 257 Aa

Rv1221 doesn't seem to be a targeted by any drug.

Rv1221 doesn't seem to be involved in any pathway.

Proteogenomic analysis of Mycobacterium tuberculosis by high resolution mass spectrometry.: Mol Cell Proteomics. 2011 Dec;10(12):M111.011627. doi: 10.1074/mcp.M111.011445. Epub 2011 Oct 3.
RseA, the SigE specific anti-sigma factor of Mycobacterium tuberculosis, is inactivated by phosphorylation-dependent ClpC1P2 proteolysis.: Mol Microbiol. 2010 Feb;75(3):592-606. doi: 10.1111/j.1365-2958.2009.07008.x. Epub 2009 Dec 16.
Evidence of complex transcriptional, translational, and posttranslational regulation of the extracytoplasmic function sigma factor sigmaE in Mycobacterium tuberculosis.: J Bacteriol. 2008 Sep;190(17):5963-71. doi: 10.1128/JB.00622-08. Epub 2008 Jul 7.
Mycobacterium tuberculosis sigma factor E regulon modulates the host inflammatory response.: J Infect Dis. 2008 Sep 15;198(6):877-85. doi: 10.1086/591098.
Evidence for complex interactions of stress-associated regulons in an mprAB deletion mutant of Mycobacterium tuberculosis.: Microbiology. 2007 Apr;153(Pt 4):1229-42. doi: 10.1099/mic.0.29281-0.
MprAB is a stress-responsive two-component system that directly regulates expression of sigma factors SigB and SigE in Mycobacterium tuberculosis.: J Bacteriol. 2006 Mar;188(6):2134-43. doi: 10.1128/JB.188.6.2134-2143.2006.
The extra cytoplasmic function sigma factor sigma(E) is essential for Mycobacterium tuberculosis virulence in mice.: Infect Immun. 2004 May;72(5):3038-41. doi: 10.1128/iai.72.5.3038-3041.2004.
Evaluation of a nutrient starvation model of Mycobacterium tuberculosis persistence by gene and protein expression profiling.: Mol Microbiol. 2002 Feb;43(3):717-31.
The Mycobacterium tuberculosis ECF sigma factor sigmaE: role in global gene expression and survival in macrophages.: Mol Microbiol. 2001 Jul;41(2):423-37.
The alternative sigma factor SigH regulates major components of oxidative and heat stress responses in Mycobacterium tuberculosis.: J Bacteriol. 2001 Oct;183(20):6119-25. doi: 10.1128/JB.183.20.6119-6125.2001.
Differential expression of 10 sigma factor genes in Mycobacterium tuberculosis.: Mol Microbiol. 1999 Jan;31(2):715-24.
Deciphering the biology of Mycobacterium tuberculosis from the complete genome sequence.: Nature. 1998 Jun 11;393(6685):537-44. doi: 10.1038/31159.
A mycobacterial extracytoplasmic function sigma factor involved in survival following stress.: J Bacteriol. 1997 May;179(9):2922-9. doi: 10.1128/jb.179.9.2922-2929.1997.