sugB
- Type
- protein_coding
- Name
- sugB
- Locus Name
-
Rv1237
- Product
-
Probable sugar-transport integral membrane protein ABC transporter SugB
- Functional Category
-
Cell wall and cell processes
- Location
- 1379855..1380679 (+ strand)
- Gene Length
- 824 bp
- Nucleotides
-
TGGGCGCGCGGCGCGCCACGTATTGGGCCGTCCTGGACACTTTGGTCGTGGGGTACGCGTTGCTCCCGGTGCTGTGGATTTTCAGCCTGTCACTCAAGCCGACGTCAACGGTCAAGGACGGCAAGCTGATTCCGTCGACGGTGACTTTCGACAACTATCGTGGCATCTTCCGGGGCGACTTGTTCAGCTCAGCGCTGATCAACTCCATCGGAATCGGCCTGATCACCACCGTGATCGCGGTGGTGCTCGGCGCGATGGCGGCCTACGCGGTTGCCCGGCTGGAATTTCCGGGCAAGCGGCTGCTAATCGGGGCTGCCTTGCTGATCACGATGTTCCCGTCGATCTCTTTGGTCACACCATTGTTCAACATCGAACGTGCCATCGGCCTGTTCGACACCTGGCCGGGGTTGATCTTGCCGTACATCACCTTCGCGTTGCCGCTCGCGATCTACACCCTGTCGGCGTTCTTCCGGGAGATCCCTTGGGATCTGGAAAAGGCGGCCAAGATGGACGGTGCAACGCCCGGTCAGGCTTTCCGGAAGGTGATCGTACCGCTGGCGGCGCCGGGCTTGGTGACCGCTGCAATCCTGGTGTTCATTTTCGCCTGGAACGATCTGCTGCTCGCGTTGTCGCTGACCGCTACCAAGGCGGCGATTACCGCGCCGGTGGCCATCGCCAACTTCACCGGCAGTTCGCAATTCGAGGAGCCGACCGGCTCGATCGCGGCCGGCGCGATCGTGATTACGATCCCGATCATCGTCTTTGTTTTAATCTTCCAACGACGGATTGTCGCCGGGTTGACCTCTGGCGCTGTGAAGGGATAG
- Drug Resistance
- Mutations
- Function
- Part of the ABC transporter complex LpqY-SugA-SugB-SugC, which is highly specific for uptake of trehalose. Involved in the recycling of extracellular trehalose released from trehalose-containing molecules synthesized by M.tuberculosis. Trehalose uptake is essential for virulence. Probably responsible for the translocation of the substrate across the membrane. {ECO:0000269|PubMed:21118978}.
- Family
-
Binding-protein-dependent transport system permease family
- GO
-
- growth of symbiont in host GO:0044117 biological_process
- transmembrane transport GO:0055085 biological_process
- carbohydrate transport GO:0008643 biological_process
- plasma membrane GO:0005886 cellular_component
- integral component of membrane GO:0016021 cellular_component
- InterPro
Summary
- Name
- Trehalose transport system permease protein SugB
- Family
- Binding-protein-dependent transport system permease family
- Protein Sequence
-
MGARRATYWAVLDTLVVGYALLPVLWIFSLSLKPTSTVKDGKLIPSTVTFDNYRGIFRGDLFSSALINSIGIGLITTVIAVVLGAMAAYAVARLEFPGKRLLIGAALLITMFPSISLVTPLFNIERAIGLFDTWPGLILPYITFALPLAIYTLSAFFREIPWDLEKAAKMDGATPGQAFRKVIVPLAAPGLVTAAILVFIFAWNDLLLALSLTATKAAITAPVAIANFTGSSQFEEPTGSIAAGAIVITIPIIVFVLIFQRRIVAGLTSGAVKG
- Mass
- 29,158 Da
- Length
- 274 Aa
Rv1237 doesn't seem to be a targeted by any drug.
Rv1237 doesn't seem to be involved in any pathway.
- Proteogenomic analysis of Mycobacterium tuberculosis by high resolution mass spectrometry.
- Mol Cell Proteomics. 2011 Dec;10(12):M111.011627. doi: 10.1074/mcp.M111.011445. Epub 2011 Oct 3.
- Trehalose-recycling ABC transporter LpqY-SugA-SugB-SugC is essential for virulence of Mycobacterium tuberculosis.
- Proc Natl Acad Sci U S A. 2010 Dec 14;107(50):21761-6. doi: 10.1073/pnas.1014642108. Epub 2010 Nov 30.
- targetTB: a target identification pipeline for Mycobacterium tuberculosis through an interactome, reactome and genome-scale structural analysis.
- BMC Syst Biol. 2008 Dec 19;2:109. doi: 10.1186/1752-0509-2-109.
- Deciphering the biology of Mycobacterium tuberculosis from the complete genome sequence.
- Nature. 1998 Jun 11;393(6685):537-44. doi: 10.1038/31159.