embR
- Type
- protein_coding
- Name
- embR
- Locus Name
-
Rv1267c
- Product
-
Probable transcriptional regulatory protein EmbR
- Functional Category
-
Regulatory proteins
- Location
- 1416181..1417347 (- strand)
- Gene Length
- 1166 bp
- Nucleotides
-
ATGGCTGGTAGCGCGACAGTGGAGAAGCGGCTCGACTTCGGCCTGCTTGGACCATTGCAGATGACTATCGACGGCACCCCGGTGCCATCGGGCACCCCCAAGCAACGGGCTGTGCTAGCCATGTTGGTCATCAACCGCAACAGGCCCGTAGGAGTCGACGCCCTAATCACCGCCCTCTGGGAGGAGTGGCCACCCTCGGGCGCACGCGCGAGTATCCACTCCTACGTGTCTAATCTGCGTAAGCTCCTCGGTGGCGCCGGGATCGACCCACGGGTGGTGTTGGCCGCAGCGCCGCCGGGTTATCGGCTCAGCATCCCCGACAACACTTGCGATCTGGGGCGGTTTGTTGCCGAAAAAACCGCGGGCGTGCACGCGGCCGCCGCCGGCCGGTTCGAACAAGCCAGCCGCCACCTGTCGGCCGCATTGAGAGAATGGCGTGGGCCGGTGCTCGATGACCTGCGCGACTTCCAGTTCGTCGAACCCTTTGCCACGGCGCTGGTAGAAGACAAGGTTCTTGCCCATACCGCCAAGGCGGAGGCCGAAATCGCGTGTGGGCGGGCCAGCGCAGTGATCGCCGAGCTCGAGGCTCTGACATTCGAACACCCCTACCGGGAGCCGCTGTGGACACAGCTGATCACCGCCTACTACCTCTCCGACCGGCAATCCGATGCGCTGGGCGCCTATCGCCGGGTGAAGACAACACTGGCCGACGACCTCGGCATCGACCCCGGTCCGACGTTGCGCGCTCTCAACGAGCGGATTCTGCGTCAGCAACCGCTGGATGCCAAGAAGTCCGCCAAAACCACCGCTGCCGGCACCGTCACGGTGCTCGATCAGCGCACCATGGCGTCGGGCCAGCAGGCGGTGGCCTACCTGCACGACATCGCCTCGGGTCGCGGCTACCCACTGCAAGCCGCGGCGACCCGGATCGGGCGTCTGCATGACAACGACATCGTCCTAGACAGCGCCAACGTCAGCCGCCACCACGCCGTCATCGTCGACACGGGCACCAACTACGTCATCAACGACCTCCGATCGTCCAACGGCGTGCATGTGCAGCACGAGCGAATCCGCTCCGCGGTCACGCTGAACGACGGCGACCACATTCGCATCTGTGACCATGAATTCACGTTCCAGATCAGCGCGGGGACGCATGGCGGCACGTA
- Drug Resistance
- Mutations
- Function
- Positively regulates the transcription of the embCAB operon. Exhibits ATPase and GTPase activities. {ECO:0000269|PubMed:16585755, ECO:0000269|PubMed:16817899}.
- Family
-
AfsR/DnrI/RedD regulatory family
- GO
-
- phosphorelay signal transduction system GO:0000160 biological_process
- ATPase activity GO:0016887 molecular_function
- plasma membrane GO:0005886 cellular_component
- regulation of transcription, DNA-templated GO:0006355 biological_process
- DNA binding GO:0003677 molecular_function
- cell wall GO:0005618 cellular_component
- GTPase activity GO:0003924 molecular_function
- InterPro
2FEZ
- Name
- Transcriptional regulatory protein EmbR
- Family
- AfsR/DnrI/RedD regulatory family
- Protein Sequence
-
MAGSATVEKRLDFGLLGPLQMTIDGTPVPSGTPKQRAVLAMLVINRNRPVGVDALITALWEEWPPSGARASIHSYVSNLRKLLGGAGIDPRVVLAAAPPGYRLSIPDNTCDLGRFVAEKTAGVHAAAAGRFEQASRHLSAALREWRGPVLDDLRDFQFVEPFATALVEDKVLAHTAKAEAEIACGRASAVIAELEALTFEHPYREPLWTQLITAYYLSDRQSDALGAYRRVKTTLADDLGIDPGPTLRALNERILRQQPLDAKKSAKTTAAGTVTVLDQRTMASGQQAVAYLHDIASGRGYPLQAAATRIGRLHDNDIVLDSANVSRHHAVIVDTGTNYVINDLRSSNGVHVQHERIRSAVTLNDGDHIRICDHEFTFQISAGTHGGT
- Mass
- 41,933 Da
- Length
- 388 Aa
Summary
Rv1267c doesn't seem to be a targeted by any drug.
Rv1267c doesn't seem to be involved in any pathway.
- Molecular structure of EmbR, a response element of Ser/Thr kinase signaling in Mycobacterium tuberculosis.
- Proc Natl Acad Sci U S A. 2006 Feb 21;103(8):2558-63. doi: 10.1073/pnas.0507766103. Epub 2006 Feb 13.
- Proteogenomic analysis of Mycobacterium tuberculosis by high resolution mass spectrometry.
- Mol Cell Proteomics. 2011 Dec;10(12):M111.011627. doi: 10.1074/mcp.M111.011445. Epub 2011 Oct 3.
- Novel substrates of Mycobacterium tuberculosis PknH Ser/Thr kinase.
- Biochem Biophys Res Commun. 2007 Mar 30;355(1):162-8. doi: 10.1016/j.bbrc.2007.01.122. Epub 2007 Jan 30.
- Transcriptional control of the mycobacterial embCAB operon by PknH through a regulatory protein, EmbR, in vivo.
- J Bacteriol. 2006 Apr;188(8):2936-44. doi: 10.1128/JB.188.8.2936-2944.2006.
- EmbR, a regulatory protein with ATPase activity, is a substrate of multiple serine/threonine kinases and phosphatase in Mycobacterium tuberculosis.
- FEBS J. 2006 Jun;273(12):2711-21. doi: 10.1111/j.1742-4658.2006.05289.x.
- Deciphering the biology of Mycobacterium tuberculosis from the complete genome sequence.
- Nature. 1998 Jun 11;393(6685):537-44. doi: 10.1038/31159.
- An FHA phosphoprotein recognition domain mediates protein EmbR phosphorylation by PknH, a Ser/Thr protein kinase from Mycobacterium tuberculosis.
- Biochemistry. 2003 Dec 30;42(51):15300-9. doi: 10.1021/bi035150b.